DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and Grik

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001262788.1 Gene:Grik / 42476 FlyBaseID:FBgn0038840 Length:907 Species:Drosophila melanogaster


Alignment Length:373 Identity:89/373 - (23%)
Similarity:144/373 - (38%) Gaps:78/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 GFHLTLILRDLLHCKMKFIFSDSW------------SKSDVVGGSVGAVVDQTADLTATPSLATE 295
            ||.:.||  |.|..|:.  ||.:|            .|:....|.:..::|..||:..|....|.
  Fly   442 GFGIELI--DELSKKLG--FSYTWRLQEDNKYGGIDPKTGEWNGMLREIIDSRADMGITDLTMTS 502

  Fly   296 GRLKYLSAIIETGF-----FRSV---CIFRTPHNAGLRGDVFLQPFSPLVWYLFGGVLSLIGVLL 352
            .|        |:|.     |.|:   .:||.|.....:...|:.|||..||...|  |:.:||. 
  Fly   503 ER--------ESGVDFTIPFMSLGIGILFRKPMKEPPKLFSFMSPFSGEVWLWLG--LAYMGVS- 556

  Fly   353 WITFYMECKRMQKRW-----------RLDYLPSLLSTFLISFGAACIQSSSLIPRSAGGRLI--- 403
             |:.::..:.....|           .|:...|..:....|.||...|.|.|.|::...|.:   
  Fly   557 -ISMFVLGRLSPAEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAAS 620

  Fly   404 --YFALFLISFIMYNYYTSVVVSSLLSSPVK-----SKIKTMRQLAESSLTVGLEPLPFTKSYLN 461
              :|.|.|:|....|....:.|.||: :|:.     ||.|       ..:..|.:....|.::..
  Fly   621 WWFFTLILVSSYTANLAAFLTVESLV-TPINDADDLSKNK-------GGVNYGAKIGGATFNFFK 677

  Fly   462 YSRLPEIHLFIKRKIESQTQNPELWLPAEQ-GVLRVRDNPGYVYVFETSSGYAYVERYFTAQEIC 525
            .|..|.    .:|..|....||:......| ||.|| :|..|.::.|:::    :| |.|.:. |
  Fly   678 ESNYPT----YQRMYEFMRDNPQYMTNTNQEGVDRV-ENSNYAFLMESTT----IE-YITERR-C 731

  Fly   526 DLNEV-LFRPEQLFYTHLHRNSTYKELFRLRFLRILETGVYRKQRSYW 572
            .|.:| ....|:.:...:.:|..|::......|.:.|.|:..|.::.|
  Fly   732 TLTQVGALLDEKGYGIAMRKNWPYRDTLSQAVLEMQEQGLLTKMKTKW 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 60/259 (23%)
GrikNP_001262788.1 PBP1_iGluR_Kainate 37..391 CDD:107377
ANF_receptor 53..374 CDD:279440
Periplasmic_Binding_Protein_Type_2 411..781 CDD:304360 89/373 (24%)
Lig_chan 543..816 CDD:278489 60/260 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.