DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and Ir7b

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:366 Identity:61/366 - (16%)
Similarity:116/366 - (31%) Gaps:130/366 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 PFSPLVWYLFGGVLSLIGVLLWITFYMECKRMQKRWRLDY-LP--SLLSTFLISFGAACIQSSSL 393
            ||:||:|...|.||.|..:||.:..         |||..: ||  ......:::.|...  ....
  Fly   330 PFTPLLWRAIGLVLILACLLLMLLV---------RWRHHHELPRNPYYELLVLTMGGNL--EDRW 383

  Fly   394 IPRSAGGRLIYFALFLISFIMYNYYTSVVVSSLLSSPVKSKIKTMRQLAESSLTVGLEPLPFTKS 458
            :|:....||:.......:.::.:.|.|.:...|.....::..:|:.::.....|:.|       :
  Fly   384 VPQRFPSRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQL-------A 441

  Fly   459 YLNYSR----LPEIHLFIKRKIESQTQNPELWLPAEQGVLRVRDNPGYVYVFETSSGYAYVERYF 519
            .:|.:|    |||:             .||..:..|...|:     .:..:.:.|...|.|    
  Fly   442 EVNEARILASLPEL-------------RPEQLVYLEGSELQ-----SFPALAQQSGSSARV---- 484

  Fly   520 TAQEICDLNEVLFRPEQLF--YTHLHRNSTYKELFRLRFLRILETGVYRKQRSYWVHMKLHCV-- 580
                      .:..|.:.|  :..:|..|        |.|.::...:|.:|.:::|....|.|  
  Fly   485 ----------AILTPYEYFGYFRKVHPMS--------RRLHLVRERIYTQQLAFYVRRHSHLVGV 531

  Fly   581 -----------------AQNFVITV---------------------------------------- 588
                             .:.:|..|                                        
  Fly   532 LNKQIQHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVR 596

  Fly   589 ----GMEYVAPLLLMLICADILVVVILLVELAWKRFFTRHL 625
                .|..:|.|..:::.|::..||:.::||...|...|.:
  Fly   597 QNVLSMRELAALFWLILWANLGAVVVFVLELLLPRIKLRKI 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 50/337 (15%)
Ir7bNP_572410.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.