DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and Grik3

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001106187.1 Gene:Grik3 / 298521 RGDID:71027 Length:919 Species:Rattus norvegicus


Alignment Length:486 Identity:100/486 - (20%)
Similarity:189/486 - (38%) Gaps:124/486 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GNREQLTDVVLRVATVVTQRPLTLSDDELIRFLSQENDTHIDSLARFGFHLTLILRDLLHC---- 256
            |....:||.:...:.:||    ||.::..:.|  :::|..:....||..:...:|::|.|.    
  Rat   422 GRGPNVTDSLTNRSLIVT----TLLEEPFVMF--RKSDRTLYGNDRFEGYCIDLLKELAHILGFS 480

  Fly   257 -KMKFIFSDSWSKSDVVG---GSVGAVVDQTADLTATPSLATEGRLKYLSAIIETGFFRSV---C 314
             :::.:....:...|..|   |.|..::|..|||...|...|..|.|   ||..:..|.::   .
  Rat   481 YEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREK---AIDFSKPFMTLGVSI 542

  Fly   315 IFRTPHNAGLRGDVFLQPFSPLVW------YLFGGVLSLIGVLLWITFYMECKRMQKRWRLDYLP 373
            ::|.|:........||.|.||.:|      ||  ||..::.|:...:.|        .| .|..|
  Rat   543 LYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYL--GVSCVLFVIARFSPY--------EW-YDAHP 596

  Fly   374 ------------SLLSTFLISFGAACIQSSSLIPRSAGGRLI-----YFALFLISFIMYNYYTSV 421
                        :||::|....|:...|.|.|:|::...|:|     :|.|.:||     .||:.
  Rat   597 CNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIIS-----SYTAN 656

  Fly   422 VVSSLLSSPVKSKIKTMRQLAE------SSLTVGLEPLPFTKSYLNYSRLPEIHLFIKRKIESQT 480
            :.:.|....::|.|.:...||:      .::..|.....|.||.:  |...::..|:..|..:..
  Rat   657 LAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKI--STFEKMWAFMSSKPSALV 719

  Fly   481 QNPELWLPAEQGVLRVRDNPGYVYVFETSSGYAYVERYFTAQEICDLNEV----------LFRPE 535
            :|      .|:|:.|.. ...|..:.|:::    :| |.| |..|:|.::          :..| 
  Rat   720 KN------NEEGIQRTL-TADYALLMESTT----IE-YIT-QRNCNLTQIGGLIDSKGYGIGTP- 770

  Fly   536 QLFYTHLHRNSTYKELFRLRFLRILETGVYRKQRSYWVHMKLHCVAQNF-------------VIT 587
                    ..|.|::...:..|::.|..            |||.:.:.:             ...
  Rat   771 --------MGSPYRDKITIAILQLQEED------------KLHIMKEKWWRGSGCPEEENKEASA 815

  Fly   588 VGMEYVAPLLLMLICADILVVVILLVELAWK 618
            :|::.:..:.::|....:|.|::.:.|..:|
  Rat   816 LGIQKIGGIFIVLAAGLVLSVLVAVGEFIYK 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 60/317 (19%)
Grik3NP_001106187.1 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388
ANF_receptor 55..398 CDD:279440
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 91/428 (21%)
Lig_chan 564..832 CDD:278489 60/319 (19%)
Glutamate binding 690..692 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349831
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.