DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and ZK867.2

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001355384.1 Gene:ZK867.2 / 191445 WormBaseID:WBGene00022829 Length:354 Species:Caenorhabditis elegans


Alignment Length:279 Identity:54/279 - (19%)
Similarity:93/279 - (33%) Gaps:99/279 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 IMYNYYTSVVVSSLLSSPVKSKIKTM---------RQLAESSLTVGLE-PLPFTKSYLNYSRLPE 467
            ::::|.|.|..:|:.|.||.|::..:         .||.::.:...|. ||.::..:.:..:..|
 Worm    98 VLFSYPTRVFETSIQSFPVSSRMLLLIILIATFFISQLYQTDMLAFLSVPLTYSIPFRSIKQALE 162

  Fly   468 I-----------------------HLFIK-------RKIESQTQNPEL----------------- 485
            :                       .||.|       |:....|:..:|                 
 Worm   163 LVEHQKMYIAAFENQTLLCTPTTCSLFQKSIDKNPVRRANKDTEVQDLIKKGGIYQSTVDSALLP 227

  Fly   486 ----WLPAEQGVLRVRDN--PGYVYVFETSSGYAYVERYFTAQEICDLNEVLFRPEQLFYTHLHR 544
                ||..:|..|.|||.  |.|...|..|..:..:.:.|.:.    |.|||  |.....|..|.
 Worm   228 GQLSWLNVDQKFLIVRDEDAPSYYVAFTFSKKHKKLLKKFNSA----LIEVL--PAVSLITIGHG 286

  Fly   545 NSTYKELFRLRFLRILETGVYRKQRSYWVHMKLHCVAQNFVITVGMEYVAPLLLMLICADILVVV 609
            .:|.|:.|.:|        ....:.|..::..|..:.::|:|           :..||..:..:.
 Worm   287 YNTKKKPFEIR--------TTNPRSSLSINNHLWQLFRSFII-----------ISSICLFVFGLE 332

  Fly   610 ILLVELAWKRFFTRHLTFH 628
            ||.           |..||
 Worm   333 ILF-----------HFLFH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 48/252 (19%)
ZK867.2NP_001355384.1 Lig_chan-Glu_bd 22..77 CDD:214911
Periplasmic_Binding_Protein_Type_2 <69..>103 CDD:389745 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.