DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and W02A2.5

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_502564.2 Gene:W02A2.5 / 189098 WormBaseID:WBGene00012190 Length:487 Species:Caenorhabditis elegans


Alignment Length:337 Identity:63/337 - (18%)
Similarity:118/337 - (35%) Gaps:76/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 SWSKSDVVGGSVGAVVDQTADLTATPSLATEGRLKYLSAIIETGFFRSVCIFRTPHNAGLRGDVF 329
            :||      |.:|.:.:.|||..|.....|:.|.:|..........:.|.:.|  ......|.|.
 Worm    77 TWS------GVLGYLQNGTADAVALMYQKTDTRNEYFEYSYPVTNVQPVFVAR--KKTETLGSVL 133

  Fly   330 ---LQPFSPLVW--YLFGGVLSLI------GVLLWITFYMECKRMQKRW-----RLDYLPSLLST 378
               .:|||..||  .|...||:|:      |:...:.|....:..:..|     :||.       
 Worm   134 WNAFKPFSVEVWLCLLASLVLNLLIMIAISGIEFKLLFRSRFRPWEMLWHVVQLQLDE------- 191

  Fly   379 FLISFGAACIQSSSLIPRSAGGRLIYFALFLI-SFIMYNYYTSVVVSSLLSSPVKSKIKTMRQLA 442
                      :|..::..:..|.::.|...|: |.|:...|..:::::|::|...:......::.
 Worm   192 ----------KSDDMLFYTLSGNIVLFVFALLQSGILIEVYKGMLLTALITSNGDNPFANADEMI 246

  Fly   443 ESSLTVGLEPLPFTKSYL------NYSRLPEIHLFIKRKIESQTQNPELWLPAEQGVLRVRDNPG 501
            :   .:|.:....|.:|:      :.....:.|....|  .:...||.:...:....|.:.|:..
 Worm   247 K---LIGEKKYHLTTNYMGNWYFDDLQHSDQQHFVSLR--AATASNPVIPAASVSAALDLVDSGK 306

  Fly   502 YVYVFETSS----------GYAY-------VERYFTAQE----ICDLNEVLFRPEQLFYTHLHRN 545
            |:|..:..|          .|.|       |..:|...:    |.:.|..:.. .|.|..... |
 Worm   307 YIYPIQQDSLAMQMSKERCNYVYVSDGMPQVSSFFVFTKNFSGIAEFNTQIIM-NQAFIQRTF-N 369

  Fly   546 STYKELFRLRFL 557
            ..:.|.|:|.|:
 Worm   370 KYFNEGFKLGFI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 45/262 (17%)
W02A2.5NP_502564.2 Lig_chan-Glu_bd <36..86 CDD:214911 4/14 (29%)
Periplasmic_Binding_Protein_Type_2 <74..>124 CDD:304360 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.