DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and glr-8

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001368711.1 Gene:glr-8 / 180924 WormBaseID:WBGene00001619 Length:547 Species:Caenorhabditis elegans


Alignment Length:345 Identity:76/345 - (22%)
Similarity:128/345 - (37%) Gaps:70/345 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 SWSKSDVVGGSVGAVVDQTADLTATPSLATEGR-----LKYLSAIIETGFFRSVCIFRTPHNAGL 324
            ||:      |:.|.:|....||.|..::....|     |.|......||.     :.|:|..  .
 Worm   128 SWT------GAFGQLVRGEVDLLAGGAIMEYDRSVIADLTYPFQFEPTGI-----MIRSPEK--Y 179

  Fly   325 RGDVFL---QPFSPLVWYLFGGVLSLIGVLLWITFYMECKRMQKRWRLDYLPSLLSTF---LISF 383
            ..|..|   :|||..||.:...|:.:.||:..:        |....|..|....::.|   .:.|
 Worm   180 EDDTLLIVTEPFSWEVWVITAAVILISGVIFLV--------MTNIIRKVYEEMTVTPFESIWVFF 236

  Fly   384 GAACIQSSSLIPRSAGGRLIYFALFLISFIMYNYYTSVVVS----SLLSSPVKSKIKTMRQLAES 444
            .....|.....|||...|::....:|.|..:...:|..:|:    ...:.|.::..:.:|.:.:.
 Worm   237 SIFVQQGLPEQPRSWSCRVLVALWWLASITLSATFTGSLVALFAVDKTNVPFQNIDQLVRLVKQG 301

  Fly   445 SLTVGLEPLPFTKS-YLNYSRLPEI-----HLFIKRKIESQTQNPELWLPAEQGVLRVRDNPGYV 503
            ...:.::...||:: .:..|:||..     .:.:..|::...       ...:||..||.||||.
 Worm   302 KFEIVMDENSFTRTEMIARSKLPVYRDLWHEMIVNHKVKYVN-------GIARGVAFVRANPGYA 359

  Fly   504 YV--FETSSGYAYVERYFTAQEICDLNEVLFR----PEQLFYTHLHRNSTYKELFRLRFLRILET 562
            .:  ..|.:.|||          .|...:||.    |..|... |.:||.|...|..:...::|.
 Worm   360 LLGPMATLNFYAY----------SDCKVILFNDGILPVYLSIP-LVKNSIYSPYFSTKIREMVER 413

  Fly   563 GVYRK----QRSYWVHMKLH 578
            |..:|    .|||....|::
 Worm   414 GFTQKWIADYRSYVAMQKIN 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 56/265 (21%)
glr-8NP_001368711.1 PBP2_iGluR_ligand_binding 62..424 CDD:270219 72/334 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.