DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cln3 and ril-2

DIOPT Version :9

Sequence 1:NP_001261999.1 Gene:Cln3 / 39981 FlyBaseID:FBgn0036756 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001023658.1 Gene:ril-2 / 179725 WormBaseID:WBGene00007586 Length:677 Species:Caenorhabditis elegans


Alignment Length:73 Identity:20/73 - (27%)
Similarity:26/73 - (35%) Gaps:12/73 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRQDRGLWRDLTSYWILGLC---------NNYGYVVMLSAAHDIIKQF---NPNDESEESSSGRN 80
            :|||.....|:..:.:..||         |..|..|:.....|||..|   :...|.|.||...|
 Worm   316 NRQDIVRINDVLRFIVENLCSEESEIIIRNFCGSHVLAEIPEDIIIHFTLRSITPECEVSSIMNN 380

  Fly    81 CHLVSTGA 88
            ....|..|
 Worm   381 LETSSQWA 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cln3NP_001261999.1 CLN3 40..413 CDD:280623 16/61 (26%)
ril-2NP_001023658.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10981
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.