powered by:
Protein Alignment Cln3 and ril-2
DIOPT Version :9
Sequence 1: | NP_001261999.1 |
Gene: | Cln3 / 39981 |
FlyBaseID: | FBgn0036756 |
Length: | 422 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023658.1 |
Gene: | ril-2 / 179725 |
WormBaseID: | WBGene00007586 |
Length: | 677 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 20/73 - (27%) |
Similarity: | 26/73 - (35%) |
Gaps: | 12/73 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 SRQDRGLWRDLTSYWILGLC---------NNYGYVVMLSAAHDIIKQF---NPNDESEESSSGRN 80
:|||.....|:..:.:..|| |..|..|:.....|||..| :...|.|.||...|
Worm 316 NRQDIVRINDVLRFIVENLCSEESEIIIRNFCGSHVLAEIPEDIIIHFTLRSITPECEVSSIMNN 380
Fly 81 CHLVSTGA 88
....|..|
Worm 381 LETSSQWA 388
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cln3 | NP_001261999.1 |
CLN3 |
40..413 |
CDD:280623 |
16/61 (26%) |
ril-2 | NP_001023658.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10981 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.