DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and AT5G28950

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_198247.1 Gene:AT5G28950 / 833021 AraportID:AT5G28950 Length:148 Species:Arabidopsis thaliana


Alignment Length:66 Identity:14/66 - (21%)
Similarity:29/66 - (43%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 LFGIITLRRLDVFLESEHADVPVVLQLICNAERKIVDCYVELAMEYSFEDSPI-GQTLALNPRTM 274
            :|.:::.:::..| .:...|:...:...||.:.:.:  ||....|.|..||.: ...|..|...:
plant    34 IFAMVSQKKMPSF-RNRKGDISQNMLAACNFDVEFM--YVLSGWEGSAHDSKVLNDALTRNSNRL 95

  Fly   275 P 275
            |
plant    96 P 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
AT5G28950NP_198247.1 DDE_Tnp_4 29..>85 CDD:304434 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.