powered by:
Protein Alignment CG32187 and AT5G28950
DIOPT Version :9
Sequence 1: | NP_730303.1 |
Gene: | CG32187 / 39980 |
FlyBaseID: | FBgn0052187 |
Length: | 409 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_198247.1 |
Gene: | AT5G28950 / 833021 |
AraportID: | AT5G28950 |
Length: | 148 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 14/66 - (21%) |
Similarity: | 29/66 - (43%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 LFGIITLRRLDVFLESEHADVPVVLQLICNAERKIVDCYVELAMEYSFEDSPI-GQTLALNPRTM 274
:|.:::.:::..| .:...|:...:...||.:.:.: ||....|.|..||.: ...|..|...:
plant 34 IFAMVSQKKMPSF-RNRKGDISQNMLAACNFDVEFM--YVLSGWEGSAHDSKVLNDALTRNSNRL 95
Fly 275 P 275
|
plant 96 P 96
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32187 | NP_730303.1 |
None |
AT5G28950 | NP_198247.1 |
DDE_Tnp_4 |
29..>85 |
CDD:304434 |
11/53 (21%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4585 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D822378at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.