DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and AT5G28730

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_198225.1 Gene:AT5G28730 / 832985 AraportID:AT5G28730 Length:296 Species:Arabidopsis thaliana


Alignment Length:291 Identity:54/291 - (18%)
Similarity:105/291 - (36%) Gaps:86/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TFLKIQQALEKTLCGIALPGYPSPPAQTMVSL----ALWKL--STDEHFEEIARKFRLPWALCQQ 166
            |.:::.......||.| |.|.....:.|.:||    |::.:  ::::...:||.:|    ...|:
plant    26 TLIRMSSEAFTQLCEI-LHGKYGLQSSTNISLDESVAIFLIICASNDTQRDIALRF----GHAQE 85

  Fly   167 VVRAFWHCISDNYESFIKWPNSLAAQRSTLQGYQRLDKLRCFRELFGIITLRRLDVFLESEHADV 231
            .:   |.    .:...:|....||.:      |.|..|:.         .||.:...|:.:....
plant    86 TI---WR----KFHDVLKAMERLAVE------YIRPRKVE---------ELRAISNRLQDDTRYW 128

  Fly   232 PVVLQL----------ICNAERKIVDCYVELA--------MEYSFEDSPIGQTLALNPRTMPAGS 278
            |.::.|          ||:.:.....|:|.:|        :..:..|.|:..        :|..|
plant   129 PFLMDLLGIASFNVLAICDLDMLFTYCFVGMAGSTHDARVLSAAISDDPLFH--------VPPDS 185

  Fly   279 --YLIGNDVFPLKSYLMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARRFNTLYALEARDLN 341
              ||:.:.....:.|| .|...|  .::|.                |.::..|.|:...|..::.
plant   186 KYYLVDSGYANKRGYL-APYRRE--HREAQ----------------DIISNNFLTVNLFETHNIK 231

  Fly   342 EVRL-IVES----ICAMHNICEEYE-DDGLE 366
            :... .|:|    :.|.|:..:|.: :||:|
plant   232 DYDFDNVDSENNVVQAPHDATDEQDNNDGIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
AT5G28730NP_198225.1 DDE_Tnp_4 139..>212 CDD:304434 15/83 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.