DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and AT4G29780

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_567834.2 Gene:AT4G29780 / 829100 AraportID:AT4G29780 Length:540 Species:Arabidopsis thaliana


Alignment Length:393 Identity:80/393 - (20%)
Similarity:147/393 - (37%) Gaps:79/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLANIAS-IITKDLLIDQPSVDINSGIYPLLTFDEDDDEAEIFALMQRKRALASGRKRRNSQEP 68
            ||::.:|| ..|..|....|:.||.||                                 :...|
plant   154 AVVSAVASGADTTGLAAPVPTADIASG---------------------------------SGSGP 185

  Fly    69 EDRKQDLKMPKLEW----HHPELNLLHRYTDAQFESYLHMRKLTFLKIQQALEKTLCGIALPGYP 129
            ..|:..:|....:|    ..|:      :.:.:|.....|.|.||..|.:.|:.|:.........
plant   186 SHRRLWVKERTTDWWDRVSRPD------FPEDEFRREFRMSKSTFNLICEELDTTVTKKNTMLRD 244

  Fly   130 SPPAQTMVSLALWKLSTDEHFEEIARKFRLPWALCQQVV----RAFWHCISDNYESFIKWPNSLA 190
            :.||...|.:.:|:|:|......::.:|.|..:.|.::|    ||.:..:...|   :.||:. :
plant   245 AIPAPKRVGVCVWRLATGAPLRHVSERFGLGISTCHKLVIEVCRAIYDVLMPKY---LLWPSD-S 305

  Fly   191 AQRSTLQGYQRLDKLRCFRELFGIITLRRLDVFLESEH---------------ADVPVVLQLICN 240
            ...||...::.:.|:   ..:.|.|....:.:.....|               ....:.:|.:.|
plant   306 EINSTKAKFESVHKI---PNVVGSIYTTHIPIIAPKVHVAAYFNKRHTERNQKTSYSITVQGVVN 367

  Fly   241 AERKIVDCYV----ELAMEYSFEDSPIGQTLALNPRTMPAGSYLIGNDVFPLKSYLMRPIEAE-- 299
            |:....|..:    .|..:...|.|.:.:..|  .|.|...|:::||..|||..||:.|...:  
plant   368 ADGIFTDVCIGNPGSLTDDQILEKSSLSRQRA--ARGMLRDSWIVGNSGFPLTDYLLVPYTRQNL 430

  Fly   300 CFRKDAMFNEMLRPAFELAEQVLDTLARRFNTLYALEARDLNEVRLIVESICAMHNICEEYEDDG 364
            .:.:.| |||.:.....:|....:.|..|:..|.......|.::..::.:.|.:|||||..:::.
plant   431 TWTQHA-FNESIGEIQGIATAAFERLKGRWACLQKRTEVKLQDLPYVLGACCVLHNICEMRKEEM 494

  Fly   365 LED 367
            |.:
plant   495 LPE 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
AT4G29780NP_567834.2 DDE_Tnp_4 327..485 CDD:290096 31/160 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2437
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.