DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and AT3G55350

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_191095.1 Gene:AT3G55350 / 824701 AraportID:AT3G55350 Length:406 Species:Arabidopsis thaliana


Alignment Length:393 Identity:78/393 - (19%)
Similarity:141/393 - (35%) Gaps:78/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ASGRKRRNSQEPEDRKQDLKMPKLEWHHP-ELNLLHRYTDAQ-FESYLHMRKLTFLKIQQALEKT 119
            ||.....|:.:.:|   |.....|:|... ...:....||.: |||...:.:.||        ..
plant    32 ASAAAALNNNDDDD---DSSSQSLDWWDGFSRRIYGGSTDPKTFESVFKISRKTF--------DY 85

  Fly   120 LCGIALPGYPSPPA------------QTMVSLALWKLSTDEHFEEIARKFRLPWALCQQVVRAFW 172
            :|.:....:.:.||            ...|::||.:|.:.|....|...|.:..:...|:...|.
plant    86 ICSLVKADFTAKPANFSDSNGNPLSLNDRVAVALRRLGSGESLSVIGETFGMNQSTVSQITWRFV 150

  Fly   173 HCISDNYESFIKWPNSLAAQRSTLQGYQRLDKLRCFRELFGIITLRRL-----------DVFLES 226
            ..:.:.....:.||:.|...:|      :.:|:.......|.|.:..:           .|:|:.
plant   151 ESMEERAIHHLSWPSKLDEIKS------KFEKISGLPNCCGAIDITHIVMNLPAVEPSNKVWLDG 209

  Fly   227 EHADVPVVLQLICNAERKIVDCYVELAMEYSFEDSPI-----------------GQTLALNPRTM 274
            | .:..:.||.:.:.:.:.:|  |......|..|..:                 |:.|.|:.|| 
plant   210 E-KNFSMTLQAVVDPDMRFLD--VIAGWPGSLNDDVVLKNSGFYKLVEKGKRLNGEKLPLSERT- 270

  Fly   275 PAGSYLIGNDVFPLKSYLMRPIEAE-CFRKDAMFNEMLRPAFELAEQVLDTLARRFNTLY-ALEA 337
            ....|::|:..|||..:|:.|.:.: .......||:....|.:.|:..|..|..|:..:. .:..
plant   271 ELREYIVGDSGFPLLPWLLTPYQGKPTSLPQTEFNKRHSEATKAAQMALSKLKDRWRIINGVMWM 335

  Fly   338 RDLNEVRLIVESICAMHNICEEYEDDGLEDPGHRSFSWGGVAEGVRGSEKDSKGLQRRVELLDEL 402
            .|.|.:..|:...|.:|||..:.||..|:|.             ....:.|....||..:|.||.
plant   336 PDRNRLPRIIFVCCLLHNIIIDMEDQTLDDQ-------------PLSQQHDMNYRQRSCKLADEA 387

  Fly   403 VAI 405
            .::
plant   388 SSV 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
AT3G55350NP_191095.1 DDE_Tnp_4 187..353 CDD:404270 33/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2437
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.