DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and AT3G19790

DIOPT Version :10

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_566647.1 Gene:AT3G19790 / 821516 AraportID:AT3G19790 Length:167 Species:Arabidopsis thaliana


Alignment Length:81 Identity:20/81 - (24%)
Similarity:39/81 - (48%) Gaps:21/81 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 DAMFNEMLRPAF-----ELAEQVLDTLARRFNTLYAL-----EARDLNEVRLIVESICAMHNICE 358
            |::.:||:...:     :|.:.:.|.||.|..:|.||     :..|.|:..::.:|:.|:|::  
plant    55 DSLMSEMINEWYDEMYDDLTDGLDDILAARIPSLSALRTSNKQPSDSNKTSIVFDSMKALHDL-- 117

  Fly   359 EYEDDGLEDPGHRSFS 374
                     ||.|.:|
plant   118 ---------PGVRMWS 124

Return to query results.
Submit another query.