DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Sulf2

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001239508.1 Gene:Sulf2 / 72043 MGIID:1919293 Length:908 Species:Mus musculus


Alignment Length:166 Identity:33/166 - (19%)
Similarity:55/166 - (33%) Gaps:66/166 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PSVDINSGIYPLLTFDEDDDEAEIFALMQRKRALASGRKRRNSQEPEDR---KQDLKMPKLEWHH 84
            |.:.:|..:.|.:.   |....:|.|.|..|..|    |..:|:.|.:|   |:.|::    |..
Mouse   390 PHIVLNIDLAPTIL---DIAGLDIPADMDGKSIL----KLLDSERPVNRFHLKKKLRV----WRD 443

  Fly    85 PEL----NLLHR----YTDAQFESYLHMRKLTFLKIQQALEKTLCGIALPGYPSPPAQTMVSLAL 141
            ..|    .|||:    ..:||.|::|...:......|:|..:|.|                    
Mouse   444 SFLVERGKLLHKREGDKVNAQEENFLPKYQRVKDLCQRAEYQTAC-------------------- 488

  Fly   142 WKLSTDEHFEEIARKFRLPWALCQQVVRAFWHCISD 177
                     |::.:|               |.|:.|
Mouse   489 ---------EQLGQK---------------WQCVED 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
Sulf2NP_001239508.1 AslA 76..>420 CDD:225661 8/32 (25%)
G6S 76..418 CDD:293766 7/30 (23%)
DUF3740 573..699 CDD:289325
ALP_like <787..836 CDD:304875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.