DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Harbi1

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001107265.2 Gene:Harbi1 / 690164 RGDID:1584007 Length:349 Species:Rattus norvegicus


Alignment Length:313 Identity:67/313 - (21%)
Similarity:111/313 - (35%) Gaps:89/313 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SPPAQTMVSLALWKLSTDEHFE-EIARKFRLPWALCQQVVRAFWHCISDNYESFIKWPNSLAAQR 193
            ||..|.:.:|..:   |...|: .:.....:..|...:.|......:.:....||.:|...||.:
  Rat    68 SPETQILAALGFY---TSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIHFPADEAAIQ 129

  Fly   194 STLQGYQRLDKLRCFRELFGIITLRRLDVFLESEHADVPVVLQLI-C--------NAE------R 243
            |...            |.:|:              |.:|.|:..: |        |||      |
  Rat   130 SLKD------------EFYGL--------------AGMPGVIGAVDCIHVAIKAPNAEDLSYVNR 168

  Fly   244 K-------IVDC-------YVELAMEYSFEDSPIGQTLALNPR---TMPAGSYLIGNDVFPLKSY 291
            |       :|.|       .||.:...|.:|..:.|..:|:.:   .||..|:|:|:..|.|.::
  Rat   169 KGLHSLNCLVVCDIRGALMTVETSWPGSLQDCAVLQQSSLSSQFETGMPKDSWLLGDSSFFLHTW 233

  Fly   292 LMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARRFNTL--------YALEARDLNEVRLIVE 348
            |:.|:.......:..:|........:.|:.|.||..||..|        |:.|     :...|:.
  Rat   234 LLTPLHIPETPAEYRYNRAHSATHSVIEKTLRTLCCRFRCLDGSKGALQYSPE-----KSSHIIL 293

  Fly   349 SICAMHNICEEYEDDGLEDPGHRSFSWGGVAEGVRGS-EKDSKGLQRRVELLD 400
            :.|.:|||..|:..|....|             |.|. |:..:|...::|.||
  Rat   294 ACCVLHNISLEHGMDVWSSP-------------VTGPIEQPPEGEDEQMESLD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
Harbi1NP_001107265.2 DDE_Tnp_4 148..300 CDD:290096 35/156 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.