DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and si:ch73-257c13.2

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_005160827.1 Gene:si:ch73-257c13.2 / 566826 ZFINID:ZDB-GENE-081104-269 Length:397 Species:Danio rerio


Alignment Length:377 Identity:78/377 - (20%)
Similarity:144/377 - (38%) Gaps:76/377 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RKRALASGRKRRNSQ--------EPEDRKQDLKMPKLEWHHPELNLLHRYTDAQFESYLHMRKLT 108
            |||..||..|.:|.:        |.:|.|.....           :|...|.:.|:|:..:....
Zfish    29 RKRRRASSVKLKNEESVQVNLKREDDDGKVVFNA-----------VLQSLTISDFKSHFQLTPTQ 82

  Fly   109 FLKIQQALEKTLCGIALPGYPSPPAQTMVSLALWKLSTDEHFEEIARKFRLPWALCQQVVRAFWH 173
            ..::.|.|..  |..|............|..:||.|||.|.::.:|.:|.:..:|....:..|..
Zfish    83 TEELVQLLAP--CKWAAIRQEDWTVWHAVLSSLWTLSTQESYQSVANRFHVAESLICDQMDEFCT 145

  Fly   174 CISDNYESFIKWPNSLAAQRSTLQGYQRLDKLRCFRELFGIITL---------RRLDVFLESEHA 229
            .::.|..:.|.||.:..|.             .|.:..|..:.|         |.:.:...::..
Zfish   146 LVTTNLANHIHWPQAEEAD-------------MCVKGFFSAVGLPDTLCVVGTRLIPIMKPTDVP 197

  Fly   230 DVPVV----------LQLICNAERKIVDCYVELAMEYSFEDS------PIGQTLALNPRTMPAGS 278
            |..|.          |...|:.:.:..  ||......::.:|      .:|:.|..:|..:..|.
Zfish   198 DSEVYRDTEGAYFAKLMAFCDHKGRFT--YVSAEHPINWHNSRVLSATEVGKALQEDPVALLHGK 260

  Fly   279 YLIGNDVFPLKSYLMRPI-EAECF-RKDAMFNEMLRPAFELAEQVLDTLARRFNTLYALEARDLN 341
            :::|:..|||..:::.|. :...| :|...:|:.:|.|..:.:..:.||...|..|..|:...:.
Zfish   261 HILGDSTFPLTEHVLTPFPDYGTFGQKKVCYNQKVRSALAVVQGSIHTLRSCFQRLGCLQKHSVC 325

  Fly   342 EVRLIVESICAMHNI-CEEY-------EDDGLEDPGH-----RSFSWGGVAE 380
            :..|.|::.|.::|: .|.|       :||..:.|.|     .|.|.||:::
Zfish   326 QTSLSVKACCILYNMYLETYNVIVDCMDDDIPQKPFHELPYGHSGSLGGISK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
si:ch73-257c13.2XP_005160827.1 DDE_Tnp_4 187..339 CDD:304434 29/153 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D538878at33208
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 1 1.000 - - otm26423
orthoMCL 1 0.900 - - OOG6_107970
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.