DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and harbi2

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001122281.1 Gene:harbi2 / 560936 ZFINID:ZDB-GENE-030131-3975 Length:351 Species:Danio rerio


Alignment Length:280 Identity:52/280 - (18%)
Similarity:102/280 - (36%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LCGIALPGYPSPPAQT-------MVSLALWKLSTDEHFEEIARKFRLPWALCQQVVRAFWHCISD 177
            ||.:..|...:|..::       |:.:||...::.....|:....:|......:.:|.....:..
Zfish    55 LCRLLEPHIKNPTRRSHATTVPQMICIALRFFTSGTFLYEVGDAEKLSKNTVCRTIRRVVIALQR 119

  Fly   178 NYESFIKWPNSLAAQRSTLQGYQRLDKLRCFRELFGII------------TLRRLDVFLESEHAD 230
            ...:|:.:|..|..| :..:|:.::..|.      |:|            .::.::....:.:|.
Zfish   120 YINTFVAFPGHLPTQ-AIKEGFSQIAGLP------GVIGAIDCIHIPISTPVKEIEATFLNRNAT 177

  Fly   231 VPVVLQLICNAERKIVDCYVELAMEYSFEDSPIGQTLALNPRTMPA--GSYLIGNDVFPLKSYLM 293
            ..:.:|:.|:.:..|..  ::.....|.:|:.|.:...|..|....  ...|:|:..:..:|:|:
Zfish   178 HSINVQMTCDHQCLITS--LDARWPGSMQDNQIFEKSKLCQRFQQGLFDGVLVGDGTYACQSFLL 240

  Fly   294 RPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARRFNTLYALEARDL----NEVRLIVESICAMH 354
            .|......:....||..|.......:..|..|..|||.|     |||    .....||.:...:|
Zfish   241 TPYPEPKTKPQHEFNIALSQTRLKIDNTLAILKARFNCL-----RDLRVSPERASQIVGACAVLH 300

  Fly   355 NI-----------CEEYEDD 363
            ||           |::..||
Zfish   301 NIASIRKEQMPSECQQSNDD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
harbi2NP_001122281.1 DDE_Tnp_4 153..301 CDD:290096 28/154 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.