DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and ids

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001073537.1 Gene:ids / 559959 ZFINID:ZDB-GENE-061215-37 Length:561 Species:Danio rerio


Alignment Length:307 Identity:61/307 - (19%)
Similarity:89/307 - (28%) Gaps:125/307 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EERAVLANIASIITKDLLIDQPSVDINSGIYPLLTFDEDDDEAEIFALMQRKRALASGRKRRNSQ 66
            |:|.|..:....:..:||     ..:|....||.|..:.::..|...|:         |..:.||
Zfish   160 EKRKVCKDKDGTLHSNLL-----CPVNVSEMPLGTLPDMENTEEAIRLL---------RSMKGSQ 210

  Fly    67 EPEDRKQDLKMPKLEWHHPE------------------------------------------LNL 89
            :|.........|.:.:..|:                                          |||
Zfish   211 KPFFLSVGFYKPHIPFRIPQEYLKLYPIENMTLAPDPDVPKKLPDVAYNPWTDIRKREDVQALNL 275

  Fly    90 LHRYTDAQFESYLHMRKLTFL----------KIQQALEKTLCGIALPGYPSPPAQTMVSLAL--- 141
            ...|.....:..|.:|:..|.          ||.|.|:..  |:|        ..|:|.|:.   
Zfish   276 SFPYGPIPKDFQLRIRQHYFASVSYVDAQVGKILQTLDDV--GLA--------KNTIVVLSSDHG 330

  Fly   142 WKLSTDEHFEEIARKFRLPWALCQQVVRAFWHCISDNYESFIKWPNSLAAQRSTLQGYQRLDKLR 206
            |.|.  ||.|         ||                     |:.|...|.|..|..|:.....|
Zfish   331 WSLG--EHGE---------WA---------------------KYSNFDVATRVPLMVYKAGVSSR 363

  Fly   207 CFRELFGIITLRRLDVFLES-EHADVPVVLQLICNAERKIVDCYVEL 252
              |...|..|...:|||.:: ||.           .:.|||:..|||
Zfish   364 --RSRPGAKTFPFIDVFQDTREHF-----------GKGKIVNSVVEL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
idsNP_001073537.1 iduronate-2-sulfatase 29..527 CDD:293754 61/307 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.