DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Arsi

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001033588.1 Gene:Arsi / 545260 MGIID:2670959 Length:573 Species:Mus musculus


Alignment Length:99 Identity:25/99 - (25%)
Similarity:42/99 - (42%) Gaps:22/99 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAVLANIASIITKDLLIDQPSV------DINSGIY-PLLTFDEDDDEAEIFALMQRKRALASGRK 61
            |.:||.:|......:.:..|:.      |.|.|.: |..:.:|:::|.|  ....|.|:.:.|| 
Mouse   486 RTLLARLADYNRTAIPVRYPAANPRAHPDFNGGAWGPWASEEEEEEEEE--EEEGRARSFSRGR- 547

  Fly    62 RRNSQEPEDRKQDLKMPKLEWHHPELN---LLHR 92
                     ||:..|:.||.....:||   :.||
Mouse   548 ---------RKKKCKICKLRSFFRKLNTRLMSHR 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
ArsiNP_001033588.1 AslA 47..492 CDD:225661 3/5 (60%)
4-S 47..478 CDD:293753
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 515..550 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.