DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Sulf1

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001262626.1 Gene:Sulf1 / 53437 FlyBaseID:FBgn0040271 Length:1114 Species:Drosophila melanogaster


Alignment Length:426 Identity:74/426 - (17%)
Similarity:114/426 - (26%) Gaps:186/426 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ALASGRKRRNSQEPEDRKQDLKMPKLEWHHPE------LNLLHRYTDAQFESYLHMRKLTFLKIQ 113
            |.....|::|.::|.........|    |.||      .:|....|.....||.|.         
  Fly   212 AFLRSSKQQNQRKPVLLTMSFPAP----HGPEDSAPQYSHLFFNVTTHHTPSYDHA--------- 263

  Fly   114 QALEKTLCGIALPGYPSPPAQTMVSLALWKLSTDEHFEEIARKFRLPWALCQQVVRAFWHCISDN 178
                           |:|..|       |.|...|..:.:.::|                     
  Fly   264 ---------------PNPDKQ-------WILRVTEPMQPVHKRF--------------------- 285

  Fly   179 YESFIKWPNSLAAQRSTLQGYQRLDKL--RCFRELFGIITLRRLDVFLESEHA------------ 229
                   .|.|..:|  ||..|.:|..  |.:.||..:..|....:...|:|.            
  Fly   286 -------TNLLMTKR--LQTLQSVDVAVERVYNELKELGELDNTYIVYTSDHGYHLGQFGLIKGK 341

  Fly   230 ------DV--------------PVVLQLICNAERKIVDCYVELAMEYSFEDSPIGQTLALNPRTM 274
                  ||              .||.:::.|         |:||..:            |:...:
  Fly   342 SFPFEFDVRVPFLIRGPGIQASKVVNEIVLN---------VDLAPTF------------LDMGGV 385

  Fly   275 PAGSYLIGNDVFPL-------------KSYLMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTLA 326
            |...::.|..:.||             .|:|   ||:...|             |.|||:.::.|
  Fly   386 PTPQHMDGRSILPLLLSRNRAVRDNWPDSFL---IESSGRR-------------ETAEQIAESRA 434

  Fly   327 RRFNTLYALEARDL---------------NEVRLIVESICAMHNIC-----------EEYEDDGL 365
            |     ..:|.|::               .|...||.|......:.           ||.|.|..
  Fly   435 R-----LQIERRNMKLANSSLLEDFLEGAGESTTIVSSSSTAATLMSSTAQQPEDGEEEVETDNE 494

  Fly   366 EDPGHRSFSWGGVAEGVRGSEKDSKGLQRRVELLDE 401
            ||......:....|..:...:.|....:...|.||:
  Fly   495 EDDVDGDGAMDSSAAALEEDDLDDAAFEEGDEELDQ 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
Sulf1NP_001262626.1 AslA 51..>398 CDD:225661 44/271 (16%)
G6S 53..408 CDD:293766 46/281 (16%)
DUF3740 640..790 CDD:289325
ALP_like <940..989 CDD:304875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.