DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and ARSF

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_011543824.1 Gene:ARSF / 416 HGNCID:721 Length:607 Species:Homo sapiens


Alignment Length:328 Identity:51/328 - (15%)
Similarity:96/328 - (29%) Gaps:155/328 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 WHHPELNLLHRYTDAQFESYLHMRKLTFLKIQQALEKTLCGIALPGYPSPPAQTMVSLALWKLST 146
            |..|..|     |:..|||.|      :|.:|                      :|::|:..|: 
Human   191 WPDPSRN-----TELAFESQL------WLCVQ----------------------LVAIAILTLT- 221

  Fly   147 DEHFEEIARKFRLPWALCQQVV----------------RAFWHCISDNYESFIKWPNSLAAQRST 195
               |.:::....:||.|...::                ..:|.|:                   .
Human   222 ---FGKLSGWVSVPWLLIFSMILFIFLLGYAWFSSHTSPLYWDCL-------------------L 264

  Fly   196 LQGYQRLDKLRCFRELFGIITLRRLDVFLESEHADVPVVLQLICNAERKIVDCYVELAMEYSFED 260
            ::|::..::.                  :::|.|...:|.:.|...||...:.:: |...:....
Human   265 MRGHEITEQP------------------MKAERAGSIMVKEAISFLERHSKETFL-LFFSFLHVH 310

  Fly   261 SPIGQTLALNPRTMPAGSYLIGNDVFPLKSYLMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTL 325
            :|:..|   :..|..:...|.|::|..:               |:|..::|        ..:|..
Human   311 TPLPTT---DDFTGTSKHGLYGDNVEEM---------------DSMVGKIL--------DAIDDF 349

  Fly   326 ARRFNTLY--------ALEARDLNEVRLIVESICAMHNICEEYEDDGLEDPGHRSF-SWGGVAEG 381
            ..|.|||.        .||||                             .||... .|.|:.:|
Human   350 GLRNNTLVYFTSDHGGHLEAR-----------------------------RGHAQLGGWNGIYKG 385

  Fly   382 VRG 384
            .:|
Human   386 GKG 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
ARSFXP_011543824.1 AslA 44..560 CDD:225661 51/328 (16%)
ALP_like 46..570 CDD:304875 51/328 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.