DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and ARSD

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001660.2 Gene:ARSD / 414 HGNCID:717 Length:593 Species:Homo sapiens


Alignment Length:279 Identity:49/279 - (17%)
Similarity:80/279 - (28%) Gaps:124/279 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 HC---ISDNYESFIKWPNSL-------------AAQRSTLQGYQRLDKLRCFRELFGIITL---- 217
            ||   ::..::.|...|.:|             ||.|:.|.||.:...|       ||:||    
Human   161 HCHHPLNHGFDYFYGMPFTLTNDCDPGRPPEVDAALRAQLWGYTQFLAL-------GILTLAAGQ 218

  Fly   218 ---------------------------------RRLDVFLESEH--ADVPVVLQLICNAERKIVD 247
                                             ||.:..|...|  .:.|:||:...:...|...
Human   219 TCGFFSVSARAVTGMAGVGCLFFISWYSSFGFVRRWNCILMRNHDVTEQPMVLEKTASLMLKEAV 283

  Fly   248 CYVELAMEYSFEDSPIGQTLALNPRTMPAGSYLIGNDVFPLKSYLMRPIEAECFRKDAMFNEMLR 312
            .|:|     ..:..|....|:|....:|    |:....|..||            :..::.:.:.
Human   284 SYIE-----RHKHGPFLLFLSLLHVHIP----LVTTSAFLGKS------------QHGLYGDNVE 327

  Fly   313 PAFELAEQVLDTLARR--FNTLYA---------LEARDLNEVRLIVESICAMHNICEEYEDDGLE 366
            ....|..:||:.:...  .|:.:.         |||||                           
Human   328 EMDWLIGKVLNAIEDNGLKNSTFTYFTSDHGGHLEARD--------------------------- 365

  Fly   367 DPGHRSF-SWGGVAEGVRG 384
              ||... .|.|:.:|.:|
Human   366 --GHSQLGGWNGIYKGGKG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
ARSDNP_001660.2 ALP_like 40..563 CDD:304875 49/279 (18%)
AslA 40..525 CDD:225661 49/279 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.