powered by:
Protein Alignment CG32187 and ARSA
DIOPT Version :9
| Sequence 1: | NP_730303.1 |
Gene: | CG32187 / 39980 |
FlyBaseID: | FBgn0052187 |
Length: | 409 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_016884289.1 |
Gene: | ARSA / 410 |
HGNCID: | 713 |
Length: | 547 |
Species: | Homo sapiens |
| Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
| Similarity: | 17/44 - (38%) |
Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 366 EDPGHRSFSWGGVAEGVRGSEKDSKGLQRRVELLDELVAIEPGE 409
:|||......||||.......:..|.||.....||..|...|.:
Human 473 KDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ 516
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3119 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.
