DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and CG7402

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster


Alignment Length:148 Identity:30/148 - (20%)
Similarity:53/148 - (35%) Gaps:56/148 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 EDSPIGQTLALNPRTMPAGSYLIGNDVF-----------------------PLKSYL-MRPIEAE 299
            ||.|:|::...:.......| |:||...                       ||:|:. ..|::|.
  Fly   422 EDDPLGESYEQHVLASDVQS-LLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHFKCEPLKAP 485

  Fly   300 CFRKDAMFNEMLRPAFELAEQVLDTLARRFN--TLYALE----ARDLNEVR-LIVESICAMHNIC 357
            ||             |:||:...:    |:|  .:|.|:    |.:|.::| ..:.|....|:  
  Fly   486 CF-------------FDLAKDPCE----RYNLAQMYPLQLQQLADELEQIRKTAIPSARVPHS-- 531

  Fly   358 EEYEDDGLEDPGHRSFSW 375
                 |...:|...:.:|
  Fly   532 -----DSRANPTFHNGNW 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 8/37 (22%)
4-S 28..436 CDD:293753 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.