DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and CG7408

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001163462.1 Gene:CG7408 / 39991 FlyBaseID:FBgn0036765 Length:585 Species:Drosophila melanogaster


Alignment Length:105 Identity:22/105 - (20%)
Similarity:35/105 - (33%) Gaps:31/105 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 YALEARDLNEVRLIVESICAMH--------NICEEYEDDGLEDP--GHRSFS------------- 374
            |..|:.:...|.:|.|.:...|        .:.....:.||.|.  |||..|             
  Fly   381 YGYESVEREIVHVIDEDVAEPHLSYTRGKWKVISGTTNQGLYDGWLGHRETSEVDPRAVEYEELV 445

  Fly   375 -----WGGVAEGVRGSEKDSKGL--QRRVELLDELVAIEP 407
                 |..:.: |...|::...|  |.|:|..|....::|
  Fly   446 RNTSVWLQLQQ-VSFGERNISELRDQSRIECPDPATGVKP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
CG7408NP_001163462.1 AslA 31..425 CDD:225661 9/43 (21%)
4-S 35..423 CDD:293753 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.