DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and CG8646

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_610807.3 Gene:CG8646 / 36394 FlyBaseID:FBgn0033763 Length:562 Species:Drosophila melanogaster


Alignment Length:226 Identity:47/226 - (20%)
Similarity:78/226 - (34%) Gaps:79/226 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 VFLESEHA---------DVPV----VLQL--ICNAERKIVDCYVELAMEYSFEDSPIGQTL-ALN 270
            :||...||         .:||    |:::  |.|.:|:      :.|...|..|:.:||.: .|.
  Fly   209 LFLYVAHAACHSSNPYNPLPVPDNDVIKMSHIPNYKRR------KFAAMVSKMDNSVGQIVDQLR 267

  Fly   271 PRTMPAGSYLI----------GNDV-----FPLKSYLMRPIEAECFRKDAMFNEMLRPAFELAEQ 320
            ...|...|.:|          |.::     :|||.......|........|::.:|:.:..::.|
  Fly   268 KSNMLENSIIIFSSDNGGPAQGFNLNFASNYPLKGVKNTLWEGGVRAAGLMWSPLLKKSQRVSNQ 332

  Fly   321 -------------------VLDTLARRFN--TLYALEARDLNEVRLIVESICAMHNICEEYEDDG 364
                               .|..|:::.:  :::....:|....||.|     :|||     || 
  Fly   333 TMHIIDWLPTLLEAAGGQPALSNLSKQIDGQSIWRALVQDKASPRLNV-----LHNI-----DD- 386

  Fly   365 LEDPGHRSFSWGGVAEGVRGSEKDSKGLQRR 395
                     .||..|..| |..|..||...|
  Fly   387 ---------IWGSAALSV-GDWKLVKGTNYR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
CG8646NP_610807.3 AslA 25..459 CDD:225661 47/226 (21%)
4-S 26..405 CDD:293753 46/222 (21%)
DUF4976 <462..531 CDD:303608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.