DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and sulf1

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001003846.1 Gene:sulf1 / 337298 ZFINID:ZDB-GENE-030131-9242 Length:1099 Species:Danio rerio


Alignment Length:219 Identity:46/219 - (21%)
Similarity:79/219 - (36%) Gaps:66/219 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LMQRKRALASGRKRR----NSQEPEDRKQDLKMPKLEWHHPE-LNLLHRYTDAQF---------E 99
            |.:.|.:|..|.|:|    .|:..::|::|....:..:...: ....||    ||         .
Zfish   474 LQKCKGSLKEGSKKRTRSLRSRSYDNREKDCHCGERPYKAAKAARRAHR----QFGQSSNPRYRP 534

  Fly   100 SYLHMRKLTFLKIQ----------QALEKTLCGIALPGYPSPPAQTMVSLALWK----------L 144
            .::|.|....|.::          ||.:||      |..|.|     :|...::          |
Zfish   535 RFVHTRPARSLSVEFEGEIYDVDLQADDKT------PLEPRP-----ISKRHYEPEPGFDSDFGL 588

  Fly   145 STDEHFEEI----ARKFRLPWAL-----CQQVVRAFWHCISDNYESFIKW---PNSLAAQRSTLQ 197
            .:|:..||:    ......|.:|     |..::.....|..:.|:|...|   .|.:..:...||
Zfish   589 ESDDGSEEMQSDDTNAVGYPNSLKVTHKCFILINDTVRCEREIYQSSRAWKDHKNFVDHEIEQLQ 653

  Fly   198 GYQRLDKLRCFRELFGIITLRRLD 221
                 ||::..||:.|.:..||.|
Zfish   654 -----DKMKKLREVRGHLKRRRPD 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
sulf1NP_001003846.1 AslA 41..>392 CDD:225661
G6S 41..383 CDD:293766
DUF3740 540..675 CDD:289325 32/149 (21%)
ALP_like <770..819 CDD:304875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.