DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and CG32191

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001287102.1 Gene:CG32191 / 317903 FlyBaseID:FBgn0052191 Length:564 Species:Drosophila melanogaster


Alignment Length:407 Identity:91/407 - (22%)
Similarity:138/407 - (33%) Gaps:97/407 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIY--PLLTF-------DEDDDEAEIFALMQRKRALASGRKRRNSQEPEDRKQDLKMPKLEWHHP 85
            |:|  .|||.       |..|.|..:|.::....|..:     |..:|      |:.|:     .
  Fly   188 GVYVTDLLTAEAERLIKDHADKEQPLFLMLSHLAAHTA-----NEDDP------LQAPE-----E 236

  Fly    86 ELNLLHRYTDAQFESYLHM---------RKLTFLKIQQALEKTLCGIALPGYPSPPAQTMVSLAL 141
            |:.......|.....|..|         |.:|.|.....||.::  :........|:..|.|   
  Fly   237 EIQKFSYIKDPNRRKYAAMISKLDQSVGRIITALSSTDQLENSI--VIFYSDNGAPSVGMFS--- 296

  Fly   142 WKLSTDEHFEEIARKFRLPWALCQQVVRAFWHCISDNYESFIKWPNSLAAQRSTLQGYQRLDKLR 206
               :|..:|....:| ..||....:|..|.|........|..:.|..:|....||.....:    
  Fly   297 ---NTGSNFPLRGQK-NTPWEGGVRVAGAIWSSGLQARGSIFRQPLYVADWLPTLSRAADI---- 353

  Fly   207 CFRELFGIITLRRLDVFLE-SEHADVPVVLQLICNAERKIVDCYVEL-AMEYSFEDSPIGQTLAL 269
               ||...:.|..:|::.| |..||.|.|.:.|.:    |:|....| |::       :||...:
  Fly   354 ---ELDSSLKLDGIDLWPELSGSADAPHVPREILH----ILDDVWRLSALQ-------MGQWKYV 404

  Fly   270 NPRTMPAG-----SYLIGNDVFPLKSYLMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARRF 329
            |..|....     :|...:|:.|..|..     |...|..|....:.|.......|...:|.|| 
  Fly   405 NGTTASGRYDSVLTYRELDDLDPRDSRY-----AVTVRNSATSRALSRYDLRRLTQQRISLTRR- 463

  Fly   330 NTLYALEARDLNEVRLIVESICAMHNICEEYEDDGLEDPGHRSFSWGGVAEGVRGSEKDS---KG 391
              |.|:...||..         :.:.:.||...|.|.||..::        .:..||:.|   ..
  Fly   464 --LAAVRCGDLQR---------SCNPLLEECLYDILSDPCEQN--------NLVYSERHSDVLTA 509

  Fly   392 LQRRVELLDELVAIEPG 408
            |:|||:.| ...|..||
  Fly   510 LRRRVQEL-RASASRPG 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
CG32191NP_001287102.1 AslA 23..458 CDD:225661 67/317 (21%)
4-S 27..408 CDD:293753 57/262 (22%)
DUF4976 <478..540 CDD:303608 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.