powered by:
Protein Alignment CG32187 and Arsa
DIOPT Version :9
Sequence 1: | NP_730303.1 |
Gene: | CG32187 / 39980 |
FlyBaseID: | FBgn0052187 |
Length: | 409 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001030105.2 |
Gene: | Arsa / 315222 |
RGDID: | 1310381 |
Length: | 507 |
Species: | Rattus norvegicus |
Alignment Length: | 39 |
Identity: | 12/39 - (30%) |
Similarity: | 16/39 - (41%) |
Gaps: | 10/39 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 GYPSPPAQTMVSLALWKLS-TDEHFEEIARKFRLPWALC 164
|:||.....:..||...|. || |.:|.:||
Rat 40 GHPSSTTPNLDQLAAGGLRFTD---------FYVPVSLC 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32187 | NP_730303.1 |
None |
Arsa | NP_001030105.2 |
AslA |
17..470 |
CDD:225661 |
12/39 (31%) |
ALP_like |
20..503 |
CDD:304875 |
12/39 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3119 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.