DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Arsa

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001030105.2 Gene:Arsa / 315222 RGDID:1310381 Length:507 Species:Rattus norvegicus


Alignment Length:39 Identity:12/39 - (30%)
Similarity:16/39 - (41%) Gaps:10/39 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GYPSPPAQTMVSLALWKLS-TDEHFEEIARKFRLPWALC 164
            |:||.....:..||...|. ||         |.:|.:||
  Rat    40 GHPSSTTPNLDQLAAGGLRFTD---------FYVPVSLC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
ArsaNP_001030105.2 AslA 17..470 CDD:225661 12/39 (31%)
ALP_like 20..503 CDD:304875 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.