DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Gns

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_006241458.1 Gene:Gns / 299825 RGDID:1305877 Length:544 Species:Rattus norvegicus


Alignment Length:246 Identity:51/246 - (20%)
Similarity:84/246 - (34%) Gaps:77/246 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PWALCQQVVRAFWHCISDNYESF------IKWPNSLAAQRSTLQGYQRLDKLRCFRELFGIITLR 218
            ||....|..:||.:.|:...::|      ..|....|....|....:.||.  .||        |
  Rat   229 PWTAAPQYQKAFPNVIAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIKFLDD--AFR--------R 283

  Fly   219 RLDVFLESEHADVPVVLQLICNAERKIVDCYVELAMEYSFEDSPIGQ-----TLALNPRTMPAGS 278
            |....|..:    .:|.:|:     |.:|...||...|.|..|..|.     :|.::.|.:..  
  Rat   284 RWQTLLSVD----DLVEKLV-----KRLDSTGELDNTYIFYTSDNGYHTGQFSLPIDKRQLYE-- 337

  Fly   279 YLIGNDVFPLKSYLM------RPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARRFNTLYALEA 337
                   |.:|..|:      :|.:.         ::||....:|...:||           |..
  Rat   338 -------FDIKVPLLVRGPGIKPNQT---------SKMLVSNIDLGPTILD-----------LAG 375

  Fly   338 RDLNEVRLIVESICAM----------HNICEEYEDDG--LEDPGHRSFSWG 376
            .|||:.::...|:..:          .::..||:.:|  :.||...|.|.|
  Rat   376 YDLNKTQMDGTSLLPILKGDGNLTWRSDVLVEYQGEGRNVTDPTCPSLSPG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
GnsXP_006241458.1 G6S 38..487 CDD:293766 51/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.