DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and AT3G30525

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001326573.1 Gene:AT3G30525 / 28719348 AraportID:AT3G30525 Length:168 Species:Arabidopsis thaliana


Alignment Length:145 Identity:24/145 - (16%)
Similarity:47/145 - (32%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 NAERKIVD-CYVELAMEYSFEDSP----------IGQTLALNPRTMPAGSYLIGNDVFPLKS--- 290
            ||...|:. |.:.:...|.:..:|          |.|.........|:..|.:.:..:|.|.   
plant    24 NASLNIMAICDLNMLFTYIWNGAPDSCHDTVVLQIAQQSDSEFHLPPSEKYYLVDSGYPNKQGFL 88

  Fly   291 YLMRPIEAECFR--------------KDAMFNEMLRPAFELAEQVLDTLARRFNTLYALEARDLN 341
            .|.|..:....|              |..:||:.......:.|:......:::..|......:::
plant    89 ALYRSSQNRVVRYHMSQFYFGPPPRNKHELFNQCHASLRSVIERTFGVWKKKWRILSDFPRYNVH 153

  Fly   342 EVRLIVESICAMHNI 356
            ..:.:.:.|..|.||
plant   154 VQKRVKQQIYQMENI 168



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.