DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and HARBI1

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_011518327.1 Gene:HARBI1 / 283254 HGNCID:26522 Length:377 Species:Homo sapiens


Alignment Length:308 Identity:57/308 - (18%)
Similarity:102/308 - (33%) Gaps:103/308 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SPPAQTMVSLALWKLSTDEHFE-EIARKFRLPWALCQQVVRAFWHCISDNYESFIKWPNSLAAQR 193
            ||..|.:.:|..:   |...|: .:.....:..|...:.|......:.:....||::|    |..
Human    68 SPETQVLAALGFY---TSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFP----ADE 125

  Fly   194 STLQGYQRLDKLRCFRELFGIITLRRLDVFLESEHADVPVVLQLI-C--------NAE------R 243
            :::|..:        .|.:|:              |.:|.|:.:: |        |||      |
Human   126 ASIQALK--------DEFYGL--------------AGMPGVMGVVDCIHVAIKAPNAEDLSYVNR 168

  Fly   244 K---IVDCY-----------VELAMEYSFEDSPIGQTLALNPR---TMPAGSYLI---------- 281
            |   .::|.           ||.....|.:|..:.|..:|:.:   .|...|:|:          
Human   169 KGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLDLPEFHWKDW 233

  Fly   282 ------------------GNDVFPLKSYLMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARR 328
                              |:..|.|:::||.|:.......:..:|........:.|:...||..|
Human   234 LTVMSRTRIYSTFSSVNQGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSR 298

  Fly   329 FNTL--------YALEARDLNEVRLIVESICAMHNICEEYEDDGLEDP 368
            |..|        |:.|     :...|:.:.|.:|||..|:..|....|
Human   299 FRCLDGSKGALQYSPE-----KSSHIILACCVLHNISLEHGMDVWSSP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
HARBI1XP_011518327.1 DDE_Tnp_4 148..328 CDD:290096 33/184 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.