DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Arsj

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_775627.1 Gene:Arsj / 271970 MGIID:2443513 Length:598 Species:Mus musculus


Alignment Length:164 Identity:36/164 - (21%)
Similarity:58/164 - (35%) Gaps:69/164 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 YPSPPAQTMVSLALWKLSTD------EHFEEIARKFRLP-------------------WA----- 162
            ||     |::|||..::..|      :.:|.|:...|.|                   ||     
Mouse   379 YP-----TLISLAEGQIDEDIQLDGYDIWETISEGLRSPRVDILHNIDPIYTKAKNGSWAAGYGI 438

  Fly   163 ---LCQQVVRA-FWHCISDN--YESFI-----------KWPN---SLAAQRS------TLQGYQR 201
               ..|..:|. .|..::.|  |..::           :|.|   :|:..:|      |...|:|
Mouse   439 WNTAIQSAIRVQHWKLLTGNPGYSDWVPPQAFSNLGPNRWHNERITLSTGKSIWLFNITADPYER 503

  Fly   202 LDKLRCFRELFGII--TLRRLDVFLESEHADVPV 233
            :|....:.   ||:  .||||..|.::.   |||
Mouse   504 VDLSSRYP---GIVKKLLRRLSQFNKTA---VPV 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
ArsjNP_775627.1 AslA 71..507 CDD:225661 26/132 (20%)
4-S 74..507 CDD:293753 26/132 (20%)
DUF4976 <493..>531 CDD:303608 12/43 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..598 36/164 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.