DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Harbi1

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001343447.1 Gene:Harbi1 / 241547 MGIID:2443194 Length:349 Species:Mus musculus


Alignment Length:294 Identity:61/294 - (20%)
Similarity:115/294 - (39%) Gaps:51/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SPPAQTMVSLALWKLSTDEHFE-EIARKFRLPWALCQQVVRAFWHCISDNYESFIKWPNSLAAQR 193
            ||..|.:.:|..:   |...|: .:.....:..|...:.|......:.:....||.:|...||.:
Mouse    68 SPETQILAALGFY---TSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIHFPVDEAAVQ 129

  Fly   194 STLQGYQRLDKLRCFRELFGIITLRR-LDVFLESEHA-DVPVVLQ---------LICNAERKIVD 247
            |....:..|..:.      |:|.:.. :.|.:::.:| |:..|.:         ::|:....::.
Mouse   130 SLKDEFYGLAGMP------GVIGVADCIHVAIKAPNAEDLSYVNRKGLHSLNCLVVCDIRGALMT 188

  Fly   248 CYVELAMEYSFEDSPIGQTLALNPR---TMPAGSYLIGNDVFPLKSYLMRPIEAECFRKDAMFNE 309
              ||.:...|.:|..:.|..:|..:   .||..|:|:|:..|.|:|:|:.|:.......:..:|.
Mouse   189 --VETSWPGSLQDCAVLQRSSLTSQFETGMPKDSWLLGDSSFFLRSWLLTPLPIPETAAEYRYNR 251

  Fly   310 MLRPAFELAEQVLDTLARRFNTL--------YALEARDLNEVRLIVESICAMHNICEEYEDDGLE 366
            .......:.|:.|.||..||..|        |:.|     :...|:.:.|.:|||.   .|.|::
Mouse   252 AHSATHSVIERTLQTLCCRFRCLDGSKGALQYSPE-----KCSHIILACCVLHNIS---LDHGMD 308

  Fly   367 DPGHRSFSWGGVAEGVRGSEKDSKGLQRRVELLD 400
                   .|.....|  ..::..:|....:|.||
Mouse   309 -------VWSSPVPG--PIDQPPEGEDEHMESLD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
Harbi1NP_001343447.1 DDE_Tnp_4 149..300 CDD:372577 33/157 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.