Sequence 1: | NP_730303.1 | Gene: | CG32187 / 39980 | FlyBaseID: | FBgn0052187 | Length: | 409 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508560.1 | Gene: | sul-1 / 180619 | WormBaseID: | WBGene00006308 | Length: | 709 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 39/196 - (19%) |
---|---|---|---|
Similarity: | 70/196 - (35%) | Gaps: | 72/196 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 WHCISDNYESFIKWPNSLAAQRSTLQGYQRLDKLRCFRELFGIITLRRLDVFLESEHADVPVVLQ 236
Fly 237 LICNAERKIVDCYVEL------AMEYSFEDSPIGQTLALNPRTMPAGSYLIGNDVF--------- 286
Fly 287 --PLKSYLMRPIEAECFRKDAM------FNEML-RPAFELAEQVLDTLARRFNTLYALEARDLNE 342
Fly 343 V 343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32187 | NP_730303.1 | None | |||
sul-1 | NP_508560.1 | G6S | 34..376 | CDD:293766 | 39/196 (20%) |
AslA | 36..>381 | CDD:225661 | 39/196 (20%) | ||
ALP_like | <605..654 | CDD:304875 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3119 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |