DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and sul-1

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_508560.1 Gene:sul-1 / 180619 WormBaseID:WBGene00006308 Length:709 Species:Caenorhabditis elegans


Alignment Length:196 Identity:39/196 - (19%)
Similarity:70/196 - (35%) Gaps:72/196 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 WHCISDNYESFIKWPNSLAAQRSTLQGYQRLDKLRCFRELFGIITLRRLDVFLESEHADVPVVLQ 236
            ||.|..|.:.:....||...                 ||.||            ||: :......
 Worm   151 WHAIVKNSKFYNYTMNSNGE-----------------REKFG------------SEY-EKDYFTD 185

  Fly   237 LICNAERKIVDCYVEL------AMEYSFEDSPIGQTLALNPRTMPAGSYLIGNDVF--------- 286
            |:.|...|.:|.::::      |:..|: .:|.|..   :|  .|..:::..|::.         
 Worm   186 LVTNRSLKFIDKHIKIRAWQPFALIISY-PAPHGPE---DP--APQFAHMFENEISHRTGSWNFA 244

  Fly   287 --PLKSYLMRPIEAECFRKDAM------FNEML-RPAFELAEQVLDTLARRFNTLYALEARDLNE 342
              |.|.:|::       |...|      |.::| |...:..:.|.:.:.|.||.|     |:||:
 Worm   245 PNPDKQWLLQ-------RTGKMNDVHISFTDLLHRRRLQTLQSVDEGIERLFNLL-----RELNQ 297

  Fly   343 V 343
            :
 Worm   298 L 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
sul-1NP_508560.1 G6S 34..376 CDD:293766 39/196 (20%)
AslA 36..>381 CDD:225661 39/196 (20%)
ALP_like <605..654 CDD:304875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.