DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Sulf1

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_008761708.1 Gene:Sulf1 / 171396 RGDID:708554 Length:1117 Species:Rattus norvegicus


Alignment Length:272 Identity:55/272 - (20%)
Similarity:94/272 - (34%) Gaps:74/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 HCISDNYESFIKWPNSLAAQRSTLQGYQRLDKLRCFRELFGIITLRR------------------ 219
            ||..:.|:|...|.:..|.....::..|  ||::..||:.|.:..|:                  
  Rat   626 HCERELYQSARAWKDHKAYIDKEIEVLQ--DKIKNLREVRGHLKKRKPEECSCGKQSYYNKEKGV 688

  Fly   220 ---------LDVFLESEHADVPVVLQLICNAERKIVDCYVELAMEYSFEDSPIGQTLALNP---- 271
                     |..|.|:...:|...|||.....|:..:...:.......|.|..|.|...:.    
  Rat   689 KRQEKLKSHLHPFKEAAAQEVDSKLQLFKEHRRRKKERKEKKRQRKGEECSLPGLTCFTHDNNHW 753

  Fly   272 RTMP---AGSYLI----GNDVFPLKSYLMRPI-EAECFRKDAMFNEMLRPAFELAEQVLDTLARR 328
            :|.|   .||:..    .|:.:    :.:|.: |...|    :|.|......|..:...|.. :.
  Rat   754 QTAPFWNLGSFCACTSSNNNTY----WCLRTVNETHNF----LFCEFATGFLEYFDMNTDPY-QL 809

  Fly   329 FNTLYALEARDLNE--VRLIVESICAMHNIC----------EEYEDDGLEDPGHRSFSWGGVAEG 381
            .||::.:|...||:  ::|:....|..:..|          :.|..||       ..||..||  
  Rat   810 TNTVHTIERGILNQLHIQLMELRSCQGYKQCNPRPKSLDVEDSYGMDG-------KVSWSSVA-- 865

  Fly   382 VRGSEKDSKGLQ 393
               |:.:.:||:
  Rat   866 ---SDTNWQGLE 874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
Sulf1XP_008761708.1 G6S 42..384 CDD:293766
DUF3740 534..675 CDD:403667 13/50 (26%)
ALP_like <767..816 CDD:419962 10/57 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.