DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and Ids

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_006527908.1 Gene:Ids / 15931 MGIID:96417 Length:595 Species:Mus musculus


Alignment Length:196 Identity:34/196 - (17%)
Similarity:66/196 - (33%) Gaps:64/196 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DLLIDQPSVDINSGIYPLLTFDEDDDEAEIFALMQRKRALASGRKRRNSQEPEDRKQDLKMPKLE 81
            :||......|:..|..|    |:...|..|..|          .|.:.|..|.........|.:.
Mouse   183 NLLCPVDVADVPEGTLP----DKQSTEEAIRLL----------EKMKTSASPFFLAVGYHKPHIP 233

  Fly    82 WHHPELNLLHRYTDAQFESYLHMRKLT------------------FLKIQQALEKTLCGIALPGY 128
            :.:|:          :|:....:..:|                  ::.|::..:.....|::|..
Mouse   234 FRYPK----------EFQKLYPLENITLAPDPHVPDSLPPVAYNPWMDIREREDVQALNISVPYG 288

  Fly   129 PSP-PAQTMVSL------------ALWKLSTDEHFEEIARKFRLP-WALC----QQVVRAFWHCI 175
            |.| ..|...|:            :.||    ||...::|.|:|| ..||    :::.::::..:
Mouse   289 PIPEDFQHRCSICSILILRQSSCESSWK----EHLLLLSRGFQLPSEVLCLFAERKIRQSYFASV 349

  Fly   176 S 176
            |
Mouse   350 S 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
IdsXP_006527908.1 iduronate-2-sulfatase 40..586 CDD:293754 34/196 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.