DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and CG43088

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001245670.1 Gene:CG43088 / 12797977 FlyBaseID:FBgn0262534 Length:362 Species:Drosophila melanogaster


Alignment Length:324 Identity:72/324 - (22%)
Similarity:120/324 - (37%) Gaps:82/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TDAQFESYLHMRKLTFLKIQQALEKTLCGIALPGYPSPPAQTMVSLALWKLSTDEHFEEIARKFR 158
            :|..|..:..:.|:||.||.:.::..:...||    |.|.|  ::.....|.|......:|..:|
  Fly    66 SDQSFVKFYAIDKITFKKILKVVKPYVQVSAL----SHPIQ--LAAVFRYLVTGCSELAVAHDYR 124

  Fly   159 ------------------LPWALCQ-----QVVRAFWHCISDNYESFIKWPNSLAAQRSTLQGYQ 200
                              |...|||     |:.|......|.|:....|.|..:|....|..|.:
  Fly   125 VRIESSMLAKILNRFIPLLQKLLCQATISIQMSRQQMQISSKNFWEKYKLPKVVACLVGTHIGIK 189

  Fly   201 RLDKLRC--FRELFGIITLRRLDVFLESEHADVPVVLQLICNAERKIVDCYVELAMEYSF----E 259
            :..| .|  |....|..:|.                :.|:||...:|:      |.:.:|    .
  Fly   190 KPAK-DCSDFLNKKGYYSLN----------------VMLVCNDNMEII------ASDATFPGSCR 231

  Fly   260 DSPIGQ--------TLALNPRTMPAGSYLIGNDVFPLKSYLMRPIE-AECFRKDAMFNEMLRPAF 315
            ||.|..        ::.||      |.:::.|..:..:|:::.|.: ||.......||.....|.
  Fly   232 DSVIWNRSRARELLSVTLN------GHFILANSKYSQESFVLTPYKNAEIGTYQHTFNLRHAQAR 290

  Fly   316 ELAEQVLDTLARRFNTLYALEARDLNEVRLIVESICAMHNIC--------EEYEDDGLEDPGHR 371
            .:.||.::.|..||..|......:.:...:||...||:||:|        :|::.:| :|.|.|
  Fly   291 NMVEQTIEVLKNRFLCLQRGLKYEPSFCCMIVNVCCALHNLCGSQNLTITDEFQFEG-DDNGQR 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
CG43088NP_001245670.1 DDE_Tnp_4 183..330 CDD:290096 37/175 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.