DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and LOC110439709

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_021331564.1 Gene:LOC110439709 / 110439709 -ID:- Length:287 Species:Danio rerio


Alignment Length:300 Identity:63/300 - (21%)
Similarity:112/300 - (37%) Gaps:78/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 ALWKL---------STDEHFEEIARKFRLPWALCQQVVRAFWHCIS--DNYESFIKWPNSLAAQR 193
            ||:|:         ||:..:.|||.:|:..|        .|.||:.  |.....|:.|   |...
Zfish     6 ALYKVMKKDFLKTPSTEAEWREIAHEFQSKW--------QFPHCLGALDGKHIRIQPP---AKSG 59

  Fly   194 STLQGYQRLDKLRCFRELFGIITLRRLDVFLESEHADVPVVLQLICNAERKIVDCYVELAMEYSF 258
            |....|         :..|.:|.:..:|...:..:|.|        ..:.::.|..:       |
Zfish    60 SLYHNY---------KSSFSVIMMAVVDANYKFIYASV--------GTQGRVSDAGL-------F 100

  Fly   259 EDSPIGQTL---ALN---PRTMPAGSYL-----IGNDVFPLKSYLMRPIE-AECFRKDAMFNEML 311
            ..|.:.|.:   .||   |..:|:...:     :|::.:||:..||:|.. .:......:.|..|
Zfish   101 AQSDLRQAMDQGQLNFPPPEPLPSSDIIMPYMFVGDEAYPLRPDLMKPYPYRQMDHSQRILNYRL 165

  Fly   312 RPAFELAEQVLDTLARR---FNTLYALEARDLNEVRLIVESICAMHNICEEYEDDGLEDPGHRSF 373
            ..|..:.|.....||.|   |.:...||...:  |::.:.|:| :||...|...:....|...  
Zfish   166 SRARRVVENAFGILANRLRVFRSTICLEPDKV--VKITMASLC-IHNFLRERRSEAYTPPAFA-- 225

  Fly   374 SW----GGVAEG---VRGS----EKDSKGLQRRVELLDEL 402
            .|    ..:.||   ::|:    ..|.:| ||...::.::
Zfish   226 DWENNDHSIVEGNWRIQGTGSFQSVDHRG-QRNASVVAKM 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
LOC110439709XP_021331564.1 DDE_Tnp_4 45..209 CDD:315924 38/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.