DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and LOC110438156

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_021324076.1 Gene:LOC110438156 / 110438156 -ID:- Length:437 Species:Danio rerio


Alignment Length:407 Identity:86/407 - (21%)
Similarity:143/407 - (35%) Gaps:92/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FALMQRKRAL--ASGRKRRNSQE--------PEDRKQDLKM---------------PKLEWHHPE 86
            :.||:|:|.:  |...:||..|.        .:..|:.:.|               |...|.:.|
Zfish    16 YVLMKRRRDVTSADATRRREVQRRVAHRQYFHQRHKRMIMMMIAQTSRPITELPARPTRVWSNIE 80

  Fly    87 LN------LLHRYTDAQFESYLHMRKLTFLKIQQALEKTLCGIALPGY--------PSPPAQTMV 137
            ..      ::..:..:.:.....|.|.||.        .|||...|..        |:.|.:..|
Zfish    81 STDWWERVVMREFQPSDWLEKFRMTKETFF--------LLCGKLKPRLNRQDTRLRPALPLEKRV 137

  Fly   138 SLALWKLSTDEHFEEIARKFRLPWALCQQVVRAFWHCISDNYES-FIKWPNSLAAQRSTLQGYQR 201
            ::|||:|:::..:..|:..|.:..:...:.||...|.|...... :::.|:     ...|:...|
Zfish   138 AVALWRLASNVEYRTISTLFGVGRSTVCKCVRDVCHAIVLLLRPLYLRTPS-----EQELEDAAR 197

  Fly   202 LDKLRC-FRELFGIITLRRLDVFLESEHAD--------VPVVLQLICNAERKIVDCYVELAMEYS 257
            |...|. |....|.:....:.:...|.:.|        :.||.|...|...:..|  |......|
Zfish   198 LFATRWGFPHCVGAVGSLHVPIIAPSSNTDNYWNSRGWLSVVTQGAVNGLGQFWD--VCAGFPGS 260

  Fly   258 FEDSPIGQTLALNPRTM----------------PAGSYLIGNDVFPLKSYLMR--PIEAECFRKD 304
            .|.|.|.|...|..|..                |.|..::|:..:||||:|::  |..:......
Zfish   261 TEHSAILQNSTLWARGCDGGFLLRQPPLDFMGHPLGFLMLGDAGYPLKSWLLKGYPESSALTAGQ 325

  Fly   305 AMFNEMLRPAFELAEQVLDTLARRFNTLYALEARDLNEVRLIVESICAMHNICEEYEDDGLEDPG 369
            ..||..|..|..:.:|....|..|:..|.......::.|..::.:.|.:||:||.:.|...|   
Zfish   326 RAFNRRLERARSVVDQAFLRLRARWQCLLKRNDCRMDVVPTMILACCVLHNVCELHGDAFAE--- 387

  Fly   370 HRSFSWGGVAEGVRGSE 386
                .|   .|.||..|
Zfish   388 ----RW---EEAVRHEE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
LOC110438156XP_021324076.1 HTH_Tnp_4 131..179 CDD:316164 12/47 (26%)
DDE_Tnp_4 212..376 CDD:315924 34/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D538878at33208
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 1 1.000 - - otm26423
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.