DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and si:dkey-121j17.6

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_005164484.1 Gene:si:dkey-121j17.6 / 101886441 ZFINID:ZDB-GENE-121214-361 Length:429 Species:Danio rerio


Alignment Length:282 Identity:59/282 - (20%)
Similarity:110/282 - (39%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 AQTMVSLALWKLSTDEHFEEIARKFRLPWALCQQVV---------------------RAFWHCIS 176
            |:..:.:.|..|:|.|.|..::.::::..:...|:|                     .|.|..|:
Zfish    97 AKDRLYVTLLFLATGETFSSLSAQYKIGASTTSQIVMETCAALYQVMKKDYLKTPSTEAEWRTIA 161

  Fly   177 DNYESFIKWPNSLA------------AQRSTLQGYQRLDKLRCFRELFGIITLRRLDVFLESE-H 228
            .::||..::|:.|.            |:..|...|    |.|||......:......:::..: |
Zfish   162 HDFESKWQFPHCLGALGGKRIYIQPPAKTGTFDNY----KGRCFVTATAAVDANYKFIYISVDTH 222

  Fly   229 ADV----PVVLQLICN-AERKIVDCYVELAMEYSFEDSPIGQTLALNPRTMPAGSYL-IGNDVFP 287
            ...    |.....:|. .:..:::|             |..:.||.:...:|   |: :|::.:|
Zfish   223 VTASDAGPFAQSGLCKWMDSGLLNC-------------PPPEPLANSELKIP---YMFVGDETYP 271

  Fly   288 LKSYLMRPIEAE-CFRKDAMFNEMLRPAFELAEQVLDTLARRF----NTLYALEARDLNEVRLIV 347
            |:..||.|..:: ..|...:.|..|..|...|:.....||.||    ||:| ||...:  ::::.
Zfish   272 LRPDLMTPYPSKPTDRSQQILNYRLSRAQRAADNAFGILANRFRFLRNTIY-LEPEKV--LKILT 333

  Fly   348 ESICAMHNICEEYEDDGLEDPG 369
            .|:| :||...|...:|...||
Zfish   334 ASLC-IHNFLLERRSEGYAPPG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
si:dkey-121j17.6XP_005164484.1 HTH_Tnp_4 96..144 CDD:290344 8/46 (17%)
DDE_Tnp_4 177..340 CDD:304434 38/186 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.