DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and LOC101885037

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_021331034.1 Gene:LOC101885037 / 101885037 -ID:- Length:464 Species:Danio rerio


Alignment Length:327 Identity:61/327 - (18%)
Similarity:118/327 - (36%) Gaps:98/327 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EWHHPELNLLHRYTDAQFESYLHMRKLTFLKIQQALEKTLCGIALPGYPSPPAQTMVSLALWK-- 143
            |:.|....||...|.|..:.|...:...:.||:|..:       :.||      .|.:..|.|  
Zfish   142 EFTHRTTLLLLDLTQANMQLYYKNKIAFYKKIEQDFK-------VNGY------NMTNEKLRKKL 193

  Fly   144 ---LSTDEHFEEIAR---KFRLPWALCQQVVRAFWHCISDNYESFIKWPNSLAAQRSTLQGYQRL 202
               ::|.:..::..|   :.::.|...:..:...:..:.::...|:|:...:     ...|::.|
Zfish   194 GNMITTYKRAKDRCRATGEEKITWEYYKVGILYVFQLLQNDLVDFLKYFALI-----LFPGHKPL 253

  Fly   203 DKLRCFRELFGIITLRRLDVFLESEHADVPVV-------------------LQLICNAERKIVDC 248
            :.::  .|.:.|.....:...::..|  :|::                   :|:||:|...|.: 
Zfish   254 EVIK--EEFYRIAGFPNVVGCIDGSH--IPIIAPTENESDYVNRKSIHSINVQIICDAAHIITN- 313

  Fly   249 YVELAMEYSFEDSPIGQTLALNPRTMPAG---SYLIGNDVFPLKSYLMRPIEAECFRKDAMFNEM 310
             ||.....|..||.|.:...|:.| :.:|   .:|:|:..:|.:..|:.|.              
Zfish   314 -VEAKWPGSVHDSRIYRECTLSNR-LQSGEIDGFLLGDRGYPCQPTLLTPY-------------- 362

  Fly   311 LRPAFELAEQVLDTLARRFNTLYA------------LEAR--DLNEVRLIVESIC-------AMH 354
              |..|...|      :|||..:.            |:||  .|..:|:..|..|       .:|
Zfish   363 --PEPEQGPQ------QRFNVAHCKTRGRVEMTKGLLKARFQCLRHLRVTPERACDIIVACVVLH 419

  Fly   355 NI 356
            ||
Zfish   420 NI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
LOC101885037XP_021331034.1 GT1 <170..221 CDD:329061 11/63 (17%)
DDE_Tnp_4 273..420 CDD:315924 34/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.