DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and zmp:0000000634

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_009300611.1 Gene:zmp:0000000634 / 100536291 ZFINID:ZDB-GENE-130530-637 Length:430 Species:Danio rerio


Alignment Length:322 Identity:78/322 - (24%)
Similarity:124/322 - (38%) Gaps:62/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 WHHPEL-------NLLHRYTDAQFESYLHMRKLTFLKIQQALEKTL----CGIALPGYPSPPAQT 135
            |..|.:       |:|:.:.|..:..:..|.:.||..:.|.|..:|    .|...|..|    :.
Zfish    80 WAFPRIHGKVFWGNILNNFDDGMWMQHFRMSRNTFEFVLQLLSPSLKRKTTGWRKPLEP----RL 140

  Fly   136 MVSLALWKLSTDEHFEEIARKFRLPWALCQQVVRAFWHCISDNYESFIKWPNSLAAQRSTLQGYQ 200
            .:::.||..:|...:..|:..|.|..:....:||...:.:....|.||..|.....|: |:.|: 
Zfish   141 RLAVVLWWYATPSEYRTISCLFGLGISTVCMLVRQVTNALKTLCERFICLPKGERLQK-TIDGF- 203

  Fly   201 RLDKLRCFRELFGIITLRRLDVFLESEHADV----------PVVLQLICNAERKIVDCYV----- 250
               ..|.::...|.|....:.:.  ..|.|.          .:|||.:.:......|.||     
Zfish   204 ---FARGYKMCAGAIDGCHIPIL--KPHVDQAAYCNRKGWHSIVLQAVVDHNFCFTDVYVGWPGR 263

  Fly   251 -----ELAMEYSFEDSPIGQTLA-----LNPR---TMPAG----SYLIGNDVFPLKSYLMRP-IE 297
                 .||      :|||.|...     |.||   |:..|    .:|||:..:|||.:||:. :.
Zfish   264 THDARVLA------NSPIYQMAEAHDGYLFPREKSTVVDGVEVPIHLIGDAAYPLKKWLMKGFLN 322

  Fly   298 AECFRKD-AMFNEMLRPAFELAEQVLDTLARRFNTLYALEARDLNEVRLIVESICAMHNICE 358
            .:....| :.||..|..|..:.|.....|..|:..|......|:|.:..||.:.|.:|||||
Zfish   323 HQILTPDQSHFNFCLSSARMVVENSFGRLKGRWRCLLKRNDVDINIMSDIVVACCILHNICE 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
zmp:0000000634XP_009300611.1 DDE_Tnp_1 207..361 CDD:279886 38/161 (24%)
DDE_Tnp_4 215..381 CDD:290096 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D538878at33208
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.