DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32187 and LOC100493151

DIOPT Version :9

Sequence 1:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_012825361.1 Gene:LOC100493151 / 100493151 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:133 Identity:30/133 - (22%)
Similarity:51/133 - (38%) Gaps:27/133 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 LIGNDVFPLKSYLMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARRFNTL--------YALE 336
            ||.:..:|...:|:.||.......|..||:....|..:.|:....|...|..|        |:  
 Frog   203 LIRDAGYPCGRWLITPIHRPRSLADRAFNQAHVRARSVIERTFGVLKSWFRCLDKSGGSLMYS-- 265

  Fly   337 ARDLNEVRLIVESICAMHNICEEY-----EDDGLEDPGHRSFSWGGVAEGVRGSEKDSKGLQRRV 396
               ..:|...|.:...:||:...:     ..|.||||.|       ..:.|:.:  |::|.|.|.
 Frog   266 ---PTKVANFVGACAVLHNLANRHGLPGDVADDLEDPIH-------PPDPVQSA--DARGSQVRG 318

  Fly   397 ELL 399
            :::
 Frog   319 QII 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32187NP_730303.1 None
LOC100493151XP_012825361.1 Ig 41..138 CDD:299845
IG_like 49..138 CDD:214653
DDE_Tnp_4 <206..281 CDD:304434 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.