DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5589 and AT3G02065

DIOPT Version :9

Sequence 1:NP_649009.1 Gene:CG5589 / 39979 FlyBaseID:FBgn0036754 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001030621.1 Gene:AT3G02065 / 821155 AraportID:AT3G02065 Length:505 Species:Arabidopsis thaliana


Alignment Length:444 Identity:140/444 - (31%)
Similarity:227/444 - (51%) Gaps:46/444 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AAEEANETRKQYGIRVLGKN--VPPPVDSFGTLTRDFKMLPRLQQNLLSRNFDHPTPIQMQALPV 152
            ::.:|...|::..|.|.|:.  |||||.:|.:.    .:.|:|..||.:..:|.||||||||:|.
plant    83 SSHDAQLLRRKLDIHVQGQGSAVPPPVLTFTSC----GLPPKLLLNLETAGYDFPTPIQMQAIPA 143

  Fly   153 LLQRRALMACAPTGSGKTLAFLTPIINGLRA----HKTTGLR---ALVLAPTRELAQQIYRECAE 210
            .|..::|:|.|.||||||.:||.|||:....    |.:...|   |:||||||||..|:..:...
plant   144 ALTGKSLLASADTGSGKTASFLVPIISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKM 208

  Fly   211 LTRETGLRTHFISKVSEAKQKHGAE--------CKQRYDILVSTPNRVRFLLQQEPPLLDLSHVE 267
            |.:....:|..:.         |.:        .:|..::::.||.||..||.:.  .::|.::.
plant   209 LGKGLPFKTALVV---------GGDPMSGQLYRIQQGVELIIGTPGRVVDLLSKH--TIELDNIM 262

  Fly   268 WFVLDEADRLMEEGQNNFKEQLDDIYAACSNPTKCVAFFSATYTVPVAKWALRHLKNLVRITIGV 332
            .|||||.|.:::.|   |::|:..|:.|.|.|.  |..||||.:..|.|......|.::.::||.
plant   263 TFVLDEVDCMLQRG---FRDQVMQIFQALSQPQ--VLLFSATISREVEKVGGSLAKEIILVSIGN 322

  Fly   333 QNSATETVQQELLFVGSEGGKLVAIRDLVR--QGLQPPVLVFVQSKERAKQLFEEL-LYDGINVD 394
            .|...:.|.|..::|.:: .|...:.|::|  ...:||.:|:|.|:..|..|...: :..|:...
plant   323 PNKPNKAVNQLAIWVDAK-QKKQKLFDILRSQNHFKPPAVVYVSSRVGADLLANAITVVTGVKAL 386

  Fly   395 VIHAERSQHQRDNCVKAFREGSIWVLICTELMGRGIDFKGVNLVINYDFPPTTISYIHRIGRTGR 459
            .||.|:...:|.:.:.:|..|.:.||:.|.::|||:|...|..||.:|.|.|...|||.|||..|
plant   387 SIHGEKPMKERRDVMGSFLGGEVPVLVSTGVLGRGVDLLVVRQVIVFDMPSTIKEYIHVIGRASR 451

  Fly   460 AGRPGRAITFFTQEDTSNLRGIALIIKNSGGTVPEYMLQMKKVRKSEAKMRAKK 513
            .|..|.||.|..::|.:....:...:|:||..:|:.::.:     :..:|..||
plant   452 MGEKGTAIVFVNEDDRNLFPDLVAALKSSGAAIPKELINL-----TSREMHNKK 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5589NP_649009.1 SrmB 87..594 CDD:223587 140/444 (32%)
P-loop_NTPase 123..329 CDD:304359 73/220 (33%)
HELICc 349..469 CDD:238034 41/122 (34%)
AT3G02065NP_001030621.1 PLN00206 1..505 CDD:215103 140/444 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D400908at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.