DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5589 and CG7483

DIOPT Version :9

Sequence 1:NP_649009.1 Gene:CG5589 / 39979 FlyBaseID:FBgn0036754 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster


Alignment Length:378 Identity:118/378 - (31%)
Similarity:185/378 - (48%) Gaps:33/378 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 TRDFKMLP-----RLQQNLL----SRNFDHPTPIQMQALPVLLQRRALMACAPTGSGKTLAFLTP 176
            :.|.:::|     .|::.||    :..|:.|:.||.:::..:::.|.::|.|.:|:|||..|...
  Fly    19 SEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSIS 83

  Fly   177 IINGLRAHKTTGLR---ALVLAPTRELAQQIYRECAELTRETGLRTHFI---SKVSE--AKQKHG 233
            |:..|    .|.||   .|.|:||||||.||.:....|.....::.|..   :.:.|  .|..:|
  Fly    84 ILQSL----DTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYG 144

  Fly   234 AECKQRYDILVSTPNRVRFLLQQEPPLLDLSHVEWFVLDEADRLMEEGQNNFKEQLDDIYAACSN 298
            ..      |:..||.||..::::.  :|....::..||||||.::.:|   ||||:.|:|.... 
  Fly   145 QH------IVSGTPGRVFDMIKRR--VLRTRAIKMLVLDEADEMLNKG---FKEQIYDVYRYLP- 197

  Fly   299 PTKCVAFFSATYTVPVAKWALRHLKNLVRITIGVQNSATETVQQELLFVGSEGGKLVAIRDLVRQ 363
            |...|...|||....:.:...:.:.:.:||.:.......|.::|..:.|..|..|...:.||...
  Fly   198 PATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDT 262

  Fly   364 GLQPPVLVFVQSKERAKQLFEELLYDGINVDVIHAERSQHQRDNCVKAFREGSIWVLICTELMGR 428
            ......::|..:|.:...|.|::......|..:|.:..|.:||..:|.||.|...|||.|::..|
  Fly   263 LTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWAR 327

  Fly   429 GIDFKGVNLVINYDFPPTTISYIHRIGRTGRAGRPGRAITFFTQEDTSNLRGI 481
            |||.:.|:||||||.|.....|||||||:||.||.|.||.|...:|...||.|
  Fly   328 GIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5589NP_649009.1 SrmB 87..594 CDD:223587 118/378 (31%)
P-loop_NTPase 123..329 CDD:304359 62/222 (28%)
HELICc 349..469 CDD:238034 47/119 (39%)
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 118/378 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.