DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5589 and Rm62

DIOPT Version :9

Sequence 1:NP_649009.1 Gene:CG5589 / 39979 FlyBaseID:FBgn0036754 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster


Alignment Length:447 Identity:134/447 - (29%)
Similarity:222/447 - (49%) Gaps:39/447 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GDSSNQPKRKKPKKEKTLSP-KELEIQKAAEEANET-------RKQYGIRVLGKNVPPPVDSFGT 119
            |.|.:.|.|  |.....|:| |:...|:....||.:       |::..|.|.|: ||.|:..|..
  Fly   224 GGSQDLPMR--PVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQ-VPNPIQDFSE 285

  Fly   120 L-TRDFKMLPRLQQNLLSRNFDHPTPIQMQALPVLLQRRALMACAPTGSGKTLAFLTPII----N 179
            : ..|:.|     :.:..:.:..||.||.|..|:.:.....:..|.|||||||.::.|.|    |
  Fly   286 VHLPDYVM-----KEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN 345

  Fly   180 GLRAHKTTGLRALVLAPTRELAQQIYRECAELTRETGLRTHFISKVSEAKQKHG--AECKQRYDI 242
            .....:..|..||||||||||||||.:...|....:.:|.   :.|.....|.|  .:.::..:|
  Fly   346 QQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRN---TCVFGGAPKGGQMRDLQRGCEI 407

  Fly   243 LVSTPNR-VRFLLQQEPPLLDLSHVEWFVLDEADRLMEEGQNNFKEQLDDIYAACSNPTKCVAFF 306
            :::||.| :.||   .....:|....:.|||||||:::.|   |:.|:..|.:.. .|.:....:
  Fly   408 VIATPGRLIDFL---SAGSTNLKRCTYLVLDEADRMLDMG---FEPQIRKIVSQI-RPDRQTLMW 465

  Fly   307 SATYTVPVAKWALRHLKNLVRITIG-VQNSATETVQQ--ELLFVGSEGGKLVAIRDLVRQGLQPP 368
            |||:...|.:.|...|.|.::|.|| ::.||...::|  ::....|:..||..:...:....:.|
  Fly   466 SATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESP 530

  Fly   369 --VLVFVQSKERAKQLFEELLYDGINVDVIHAERSQHQRDNCVKAFREGSIWVLICTELMGRGID 431
              :::||::|.|...|...:...|:....||.::||.:||..::.||.|...:|:.|::..||:|
  Fly   531 GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLD 595

  Fly   432 FKGVNLVINYDFPPTTISYIHRIGRTGRAGRPGRAITFFTQEDTSNLRGIALIIKNS 488
            ..|:..|||:|:|..:..||||||||||:...|.:..|||:.:....:.:..:::.:
  Fly   596 VDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREA 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5589NP_649009.1 SrmB 87..594 CDD:223587 126/422 (30%)
P-loop_NTPase 123..329 CDD:304359 65/212 (31%)
HELICc 349..469 CDD:238034 41/121 (34%)
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 116/388 (30%)
DEADc 283..488 CDD:238167 66/219 (30%)
HELICc 499..633 CDD:238034 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.