DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5589 and Gem3

DIOPT Version :9

Sequence 1:NP_649009.1 Gene:CG5589 / 39979 FlyBaseID:FBgn0036754 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001261678.1 Gene:Gem3 / 39195 FlyBaseID:FBgn0011802 Length:1028 Species:Drosophila melanogaster


Alignment Length:571 Identity:140/571 - (24%)
Similarity:236/571 - (41%) Gaps:141/571 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PPPVDSFGTLTRDFKMLPRLQQNLLS----RNFDHPTPIQMQALPVLLQRRALMACAPTGSGKTL 171
            |..|.:|..|        ||.:|||:    .||..||.||..|:|:.|.:..|:..:.:|:||||
  Fly    21 PGQVKTFEEL--------RLYRNLLNGLKRNNFVTPTKIQAAAIPMALAKMDLIIQSKSGTGKTL 77

  Fly   172 AFLTPIINGLRAHKTTGLRALVLAPTRELAQQI----------YRE--CAELTRETGLRTHFISK 224
            .::..::.....: .....|:::.||||||.|:          :|:  |:.          ||..
  Fly    78 IYVIAVVQSFNPN-INQPHAMIVVPTRELAIQVQDTFFHLCKSFRDFKCSA----------FIGG 131

  Fly   225 VSEAK-QKHGAECKQRYDILVSTPNRVRFLLQQEPPLLDLSHVEWFVLDEADRLMEEGQNNFKEQ 288
            ...|| :|...|.:    :::.||.|:..|.:..  :.|:|.:...||||||:|.:  ..:.:..
  Fly   132 TDVAKDRKRMNESR----VIIGTPGRLLHLYENR--VFDVSKLRLLVLDEADQLYQ--TKSLQHT 188

  Fly   289 LDDIYAACSNPTKCVAFFSATYTVPVAKWALR------HLKNLVRITI--GV---------QNSA 336
            :..:..|.....:.:| .||||...:.:...:      .:.|..|.|:  |:         ||::
  Fly   189 VSKLIEAMPKNRQIIA-CSATYDQNLDERLAKVMDKPMLISNSERATVLLGIRQFVYELPQQNNS 252

  Fly   337 TETVQQELLFVGSEGGKLVAIRDLVRQGLQPPVLVFVQSKERAKQLFEELLYDGINVDVIHAERS 401
            .|.::.:|..:|          .:..|......::|..|:.||......|...||:..:|.....
  Fly   253 VEEMRLKLQILG----------QIFNQLPYEQAIIFASSQMRADSYKNYLTASGIDCHLISGAME 307

  Fly   402 QHQRDNCVKAFREGSIWVLICTELMGRGIDFKGVNLVINYDFPPTTISYIHRIGRTGRAGRPGRA 466
            |.:|.:..:.:|..::.:|:.|:||.||:|....|||||.|.|...::|:|||||.||.|..|.|
  Fly   308 QSERLHVFEGYRNFTMRILVATDLMARGVDSPHANLVINIDPPQDHVTYLHRIGRAGRFGSKGIA 372

  Fly   467 ITF-------------------------FTQEDTSN---------------------LRGIALII 485
            |||                         |.:|...|                     |:.:.:.|
  Fly   373 ITFIASKKESQRFREMSKKIATAWSVLEFPKEPMPNEFNFWDFEKYNFDYYIKEENPLQEMPMPI 437

  Fly   486 K--NSGGTVPEYMLQMKKVRKSEAKMRA---KKPLDREDISTKIR------PETKGDEKHKSTKL 539
            |  .|...|....:.::.::|.:...|.   |.|:..|::.|:..      ||:..:.|:...|.
  Fly   438 KENRSKENVDASSVDLENLQKDQDGKRRDPDKLPVALENVETQKELELENLPESSHNNKNLRVKE 502

  Fly   540 KKVERTEKILKNRKGYEKDLNSKQKKLGNIKTELKPAGKRKGNVEKKTKNK 590
            |::.|..|:        |:.||   |.|..||. |...::|.|...|.:.:
  Fly   503 KEIVRQGKL--------KETNS---KAGGSKTN-KTERRKKSNTPSKLQKQ 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5589NP_649009.1 SrmB 87..594 CDD:223587 140/571 (25%)
P-loop_NTPase 123..329 CDD:304359 57/228 (25%)
HELICc 349..469 CDD:238034 38/119 (32%)
Gem3NP_001261678.1 SrmB 24..541 CDD:223587 139/566 (25%)
P-loop_NTPase 27..228 CDD:304359 57/228 (25%)
Helicase_C 259..367 CDD:278689 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.