DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5589 and CG10077

DIOPT Version :9

Sequence 1:NP_649009.1 Gene:CG5589 / 39979 FlyBaseID:FBgn0036754 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001261491.1 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster


Alignment Length:437 Identity:133/437 - (30%)
Similarity:213/437 - (48%) Gaps:26/437 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PKKEKTLSPKELEIQKAAEEANETRKQYGIRVLGKNVPPPVDSF--GTLTRDFKMLPRLQQNLLS 136
            |.::....|.:..:.:...|.........|.:.|..||.|...|  |... |:.|     ..:..
  Fly   116 PFRKNFYKPCDSVLARTVGETETFLTSNEITIKGDQVPTPSIEFEEGGFP-DYVM-----NEIRK 174

  Fly   137 RNFDHPTPIQMQALPVLLQRRALMACAPTGSGKTLAFLTPII----NGLRAHKTTGLRALVLAPT 197
            :.|..||.||.|..|:.:..|.|:..|.||||||||::.|.:    |..|..:..|..|||||||
  Fly   175 QGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPT 239

  Fly   198 RELAQQIYRECAELTRETGLRTHFISKVSEAKQKHGAECKQRYDILVSTPNR-VRFLLQQEPPLL 261
            |||||||.:...|....|.:|...|.. ...|.:...:.::..:|:::||.| :.||   |....
  Fly   240 RELAQQIQQVAIEFGSNTHVRNTCIFG-GAPKGQQARDLERGVEIVIATPGRLIDFL---ERGTT 300

  Fly   262 DLSHVEWFVLDEADRLMEEGQNNFKEQLDDIYAACSNPTKCVAFFSATYTVPVAKWALRHLKNLV 326
            .|....:.|||||||:::.|   |:.|:..|.... .|.:.|..:|||:...|.:.|...|.|.:
  Fly   301 SLKRCTYLVLDEADRMLDMG---FEPQIRKIMQQI-RPDRQVLMWSATWPKEVRQLAEEFLNNYI 361

  Fly   327 RITIG-VQNSATETVQQELLFVGSEGGKLVAIRDL---VRQGLQPPVLVFVQSKERAKQLFEELL 387
            ::.|| :..||...:.| ::.|..|..||:.:..|   :....:...::||::|:|..::...:.
  Fly   362 QVNIGSLSLSANHNILQ-IVDVCDENEKLMKLIKLLTDISAENETKTIIFVETKKRVDEITRNIS 425

  Fly   388 YDGINVDVIHAERSQHQRDNCVKAFREGSIWVLICTELMGRGIDFKGVNLVINYDFPPTTISYIH 452
            ..|.....||.::||.:||..:.:||.|...:|:.|::..||:|...|..|||||:|..:..|:|
  Fly   426 RQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLDVDDVKFVINYDYPSNSEDYVH 490

  Fly   453 RIGRTGRAGRPGRAITFFTQEDTSNLRGIALIIKNSGGTVPEYMLQM 499
            |||||||:...|.|.|.||..:.:....:..:::.:..|:...::.|
  Fly   491 RIGRTGRSNNTGTAYTLFTHSNANKANDLIQVLREANQTINPKLMNM 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5589NP_649009.1 SrmB 87..594 CDD:223587 131/424 (31%)
P-loop_NTPase 123..329 CDD:304359 71/210 (34%)
HELICc 349..469 CDD:238034 41/122 (34%)
CG10077NP_001261491.1 PTZ00110 49..544 CDD:240273 133/437 (30%)
DEADc 159..364 CDD:238167 73/218 (33%)
HELICc 375..507 CDD:238034 43/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.