DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5589 and eIF4A

DIOPT Version :9

Sequence 1:NP_649009.1 Gene:CG5589 / 39979 FlyBaseID:FBgn0036754 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster


Alignment Length:373 Identity:121/373 - (32%)
Similarity:189/373 - (50%) Gaps:24/373 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DSFGTLTRDFKMLPRLQQNLLSRNFDHPTPIQMQALPVLLQRRALMACAPTGSGKTLAFLTPIIN 179
            |:|.    |..:...|.:.:....|:.|:.||.:|:...::.|.::|.|.:|:|||..|...|:.
  Fly    30 DNFD----DMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQ 90

  Fly   180 GLRAHKTTGLR---ALVLAPTRELAQQIYRECAELTRETGLRTHFI---SKVSEAKQKHGAECKQ 238
            .:    .|.:|   ||:||||||||.||.|....|.....:.:|..   :.|.|..:...:.|  
  Fly    91 QI----DTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGC-- 149

  Fly   239 RYDILVSTPNRVRFLLQQEPPLLDLSHVEWFVLDEADRLMEEGQNNFKEQLDDIYAACSNPTKCV 303
              .::|.||.||..::.::  :|...:::.|||||||.::..|   ||:|:.|::.... |...|
  Fly   150 --HVVVGTPGRVYDMINRK--VLRTQYIKLFVLDEADEMLSRG---FKDQIQDVFKMLP-PDVQV 206

  Fly   304 AFFSATYTVPVAKWALRHLKNLVRITIGVQNSATETVQQELLFVGSEGGKLVAIRDLVRQGLQPP 368
            ...|||....|.:.:...:::.|.|.:..:....|.::|..:.|..|..||..:.||........
  Fly   207 ILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQ 271

  Fly   369 VLVFVQSKERAKQLFEELLYDGINVDVIHAERSQHQRDNCVKAFREGSIWVLICTELMGRGIDFK 433
            .::|..::.:..||.:|:......|..:|.:..|..|:..:|.||.||..|||.|:|:.||||.:
  Fly   272 SVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQ 336

  Fly   434 GVNLVINYDFPPTTISYIHRIGRTGRAGRPGRAITFFTQEDTSNLRGI 481
            .|:||||||.|....:|||||||.||.||.|.||.|.|.:|...|:.|
  Fly   337 QVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5589NP_649009.1 SrmB 87..594 CDD:223587 121/373 (32%)
P-loop_NTPase 123..329 CDD:304359 61/211 (29%)
HELICc 349..469 CDD:238034 49/119 (41%)
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 121/373 (32%)
DEADc 32..232 CDD:238167 62/217 (29%)
Helicase_C 254..358 CDD:278689 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.