DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-A and YBR284W

DIOPT Version :9

Sequence 1:NP_524130.1 Gene:Adgf-A / 39976 FlyBaseID:FBgn0036752 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_009843.3 Gene:YBR284W / 852587 SGDID:S000000488 Length:797 Species:Saccharomyces cerevisiae


Alignment Length:399 Identity:88/399 - (22%)
Similarity:141/399 - (35%) Gaps:96/399 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 DGDLSASALRFSKDKPQALSD---CDWSLLSDVRAKYGADKVDDY---LAERLTLYPTKKFEDNN 234
            :|:..|..|:....|||..|.   |..|:.......|....||::   .|..|..|   ....||
Yeast   393 NGEYLAELLKTFLIKPQEESKYQLCQLSVDFQFYLHYDNSDVDNWWMVFANWLNHY---NIFSNN 454

  Fly   235 AAWS-----------------TFMSIFNLLDGLVMYAPVW--ADYYYKALEEFYEDGVLYLEFRS 280
            ..|:                 .|....||:     :.|::  .:|.:|:|      |.:.|:|.|
Yeast   455 IRWNIRISRIYPELYHTGKVKNFQEYLNLI-----FKPLFNAENYLHKSL------GPILLKFLS 508

  Fly   281 VVPT----LYDMDG---TEFTPMDTVRIYVETLEKFKEAHPD--FIGSRMIYAPIRYTNAEGVTG 336
            .|.:    :.|.|.   ..||.       |..|.|...:..|  .|...|.|.   |.|...:..
Yeast   509 QVSSIDLCIQDTDNYIWKNFTA-------VSCLPKDWTSGGDNPTISQYMYYV---YVNLTKLNH 563

  Fly   337 YIQTLKQIKEKYPEFVAGFDLVGQEEMGRPLRDFVDELLSIPDDIDFYFHAGETNWFGSTVDENL 401
            ..|.|.|.........:...:....:....| :|.:...:|.:  :|....|     |....|||
Yeast   564 IRQALHQNTFTLRSSCSPTSMNRTSQFSNTL-NFTEHTEAILN--NFLLACG-----GFLNAENL 620

  Fly   402 IDAILLGTKRIGHGFGLVKHPVVLDMLKKLNVAIEVNPISNQ-------VLQLVSDFRNHPCSHF 459
            .:|    ...:.:.|.|.:.|:|   :..||..::..|...|       ||:....::.:|...|
Yeast   621 WNA----PPSLVYLFYLSQIPMV---VAPLNSIVDSKPTMLQEQAPTGLVLEPSKPYKKNPFMKF 678

  Fly   460 FADGYPVVISSD----DPSFWKATPLTHDFYIAFLGIASQHS-DL-RLLKKLALNSIQYSSLTGD 518
            |..|:.:.:||:    :.|:.| .|:..::.:| ..|...|| || .||:...:.|...|:|.  
Yeast   679 FEMGFKISLSSESILYNNSYTK-EPIIEEYSVA-ASIYRLHSADLCELLRNSVITSGFSSTLK-- 739

  Fly   519 AQFEALEKW 527
                  .||
Yeast   740 ------NKW 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-ANP_524130.1 A_deaminase_N 54..139 CDD:285627
adm_rel 66..538 CDD:273620 88/399 (22%)
ADGF 119..531 CDD:238646 88/399 (22%)
YBR284WNP_009843.3 Add 341..748 CDD:224729 88/399 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.